Falska meddelanden som gäller skatteåterbäringar cirkulerar som sms. Mer information om falska meddelanden

Begränsning av rätten till ränteavdrag i företagsbeskattningen

Har getts
22.4.2022
Diarienummer
VH/640/00.01.00/2022
Giltighet
22.4.2022 - Tills vidare
Bemyndigande
2 § 2 mom. i lagen om Skatteförvaltningen (503/2010)
Ersätter anvisningen
VH/5598/00.01.00/2021, 24.11.2021

I anvisningen behandlas regleringen av begränsningen av rätten till ränteavdrag enligt NärSkL 18 a § och 18 b § som trädde i kraft 1.1.2019.

Anvisningen har uppdaterats på grund av ändringarna i NärSkL 18 a och b § som trädde i kraft 1.1.2022 (RP 211/2021 rd). Ändringarna medför att förutsättningarna för att tillämpa undantaget som grundar sig på en jämförelse av balansräkningar skärps och att tillämpningsområdet för undantaget som gäller långfristiga offentliga infrastrukturprojekt utvidgas till offentliga infrastrukturbolag. Därtill blir det i vissa situationer möjligt att i förvärvskällan för näringsverksamhet dra av icke avdragsgilla nettoränteutgifter som uppkommit i förvärvskällan för annan verksamhet under tidigare år. Ändringar har gjorts i kapitel 2 och 4–6.

De nya ändringarna gällande undantaget som grundar sig på en jämförelse av balansräkningar tillämpas för första gången i beskattningen för 2022. Ändringarna som gäller långfristiga offentliga infrastrukturprojekt och rätten att i förvärvskällan för näringsverksamhet dra av icke avdragsgilla nettoränteutgifter som uppkommit i förvärvskällan för annan verksamhet tillämpas redan från och med beskattningen 2020.

Anvisningen har tidigare uppdaterats med anledning av den 10.9.2021 publicerade rättspraxisen rörande ränteavdragsbegränsning.

1 Om avdragsgillheten för ränteutgifter

1.1 Allmänt

Enligt bestämmelsen i 18 § 1 mom. 2 punkten i lagen om beskattning av inkomst av näringsverksamhet (360/1968, NärSkL) är räntor på skulder som tagits för näringsverksamheten avdragsgilla. Enligt samma bestämmelse är räntorna avdragsgilla även då de är beroende av rörelsens resultat. Förutsättningen för ränteavdrag är att det handlar om den avdragsyrkande skattskyldiges ränteutgifter. Enligt 23 § i NärSkL utgör räntorna utgifter för det skatteår då de betalas. Räntor på skulder som hör till förvärvskällan för annan verksamhet och förvärvskällan för jordbruk är avdragsgilla enligt 58 § 1 mom. i inkomstskattelagen (1535/1992, ISkL) och 3 § 1 mom. i inkomstskattelagen för gårdsbruk (543/1967). NärSkL 18 a § begränsar med de undantag som föreskrivs i NärSkL 18 b § avdrag av ovan nämnda räntor i alla förvärvskällor.

På ränteavdrag i koncerners interna finansieringsarrangemang kan man i Finland tillämpa rättelse av internprissättningen enligt 31 § i lagen om beskattningsförfarande (1142/2021, BFL). En förutsättning för att tillämpa bestämmelsen om internprissättning är att räntan på skulden inte kan anses marknadsmässig.

Enligt högsta förvaltningsdomstolens beslutspraxis kan räntorna inte betraktas som avdragsgilla heller när aktierna för vilkas förvärv skulden tagits inte kan allokeras som filialens tillgångar (HFD 2016:71).

Ränteavdrag har i vissa fall avslagits i beskattnings- och rättspraxis även med stöd av BFL 28 § om kringgående av skatt (se till exempel HFD 2016:72 och HFD 2021:178).

1.2 Regleringen av begränsningen av rätten till ränteavdrag

Bestämmelserna om begränsning av avdragsrätten för ränteutgifter finns i NärSkL 18 a §. Ursprungliga NärSkL 18 a § (RP 146/2012 rd) trädde i kraft 1.1.2013 och tillämpades från skatteåret 2014. Innan bestämmelsen började tillämpas gjordes vissa ändringar i 2 momentet (lagen om ändring av lagen om beskattning av inkomst av näringsverksamhet 1238/2013 och RP 185/2013 rd). I NärSkL 18 a § gjordes mera omfattande ändringar på grund av räntebegränsningen i Europeiska unionens direktiv mot skatteflykt (2016/1164, ATAD-direktivet). Direktivet innehåller miniminormen, som medlemsstaterna ska genomföra. På grund av ATAD-direktivet ändrades NärSkL 18 a § och det stiftades en helt ny NärSkL 18 b § (se lagen om ändring av lagen om beskattning av inkomst av näringsverksamhet (1237/2018) och RP 150/2018 rd). Ändringarna som baserar sig på direktivet trädde i kraft 1.1.2019.

Ändringarna i NärSkL 18 a § och 18 b § som baserar sig på regeringens proposition (RP 211/2021 rd) om ändring av bestämmelserna om ränteavdragsbegränsning trädde i kraft 1.1.2022. Denna reglering medförde ändringar i bestämmelserna om ränteavdragsbegränsning i NärSkL 18 a och b § som trädde i kraft år 2019 (RP 150/2018 rd, FiUB 21/2018 rd).

Enligt regeringens proposition (RP 150/2018 rd) är syftet med regleringen att trygga Finlands skattebas genom mer omfattande bestämmelser om begränsning av rätten till ränteavdrag så att även tryggandet av förutsättningarna för företagsverksamhet beaktas i lagstiftningen. Med regleringen begränsas rätten att dra av ränteutgifter som i övrigt är avdragsgilla. Syftet med regleringen är också att förhindra sådan aggressiv skatteplanering i samband med ränteavdrag som har betydelse med tanke på skatteintäkterna. Tillämpningen av bestämmelsen om räntebegränsning kräver till exempel ingen utredning av de särskilda affärsekonomiska orsakerna eller skattebelastningsnivån hos den faktiska mottagaren av en inkomst som motsvarar ränteutgiften.

NärSkL 18 a § utgör inget hinder för tillämpning av den allmänna bestämmelsen om kringgående av skatt eller tillämpning av rättelse av internprissättning eftersom bestämmelserna har olika tillämpningsområden. Dessa bestämmelser kan tillämpas om tillämpningsförutsättningarna för dem uppfylls.

2 Tillämpningsområdet för regleringen

2.1 Företag som omfattas av tillämpningsområdet och deras verksamhet

Bestämmelsen om räntebegränsning tillämpas enligt NärSkL 18 a § 1 mom. på samfund, öppna bolag och kommanditbolag samt på motsvarande utländska bolag, om dessa har ett fast driftsställe i Finland eller om de på annat sätt har inkomster från Finland. Dessutom tillämpas bestämmelsen med stöd av ISkL 9 § 1 mom. 1 punkten på utländska samfund som är allmänt skattskyldiga i Finland. Begränsningen gäller exempelvis inte enskilda näringsidkare.

Med samfund avses alla samfund enligt ISkL 3 §, bland annat aktiebolag och andelslag.  Bostadsaktiebolag, ömsesidiga fastighetsbolag och så kallade Mankala-bolag är enligt lagen särskilda skattskyldiga som är skyldiga att betala samfundsskatt och omfattas därför av tillämpningsområdet för direktivet och bestämmelserna om begränsning av rätten till ränteavdrag.

Regleringen tillämpas på ränteutgifter i förvärvskällan för näringsverksamhet, jordbruk och annan verksamhet. Begränsningen av rätten till ränteavdrag beräknas separat för varje skattskyldig på basis av nettoränteutgifternas totala belopp i förvärvskällorna (se kapitel 4).

2.2 Företag och räntor som faller utanför tillämpningsområdet

2.2.1 Fristående företag

Enligt NärSkL 18 b § 1 mom. omfattas inte de fristående företag som anges i 2 momentet av bestämmelsen om räntebegränsning. Som fristående företag betraktas enligt NärSkL 18 b § 2 mom. inte ett samfund, öppet bolag eller kommanditbolag

  1. som för affärsredovisningsändamål ingår i en koncern;
  2. som har ett skattemässigt fast driftställe utomlands;
  3. som direkt eller indirekt har en andel i form av rösträtt eller kapitalinnehav motsvarande 25 procent eller mer i ett annat subjekt eller har rätt att motta 25 procent eller mer av vinsterna i det subjektet;
  4. i vars rösträtt, kapital eller vinster en fysisk person eller ett annat subjekt direkt eller indirekt har en andel på 25 procent eller mer; eller
  5. som har samband med ett eller flera andra subjekt på den grund att en fysisk person eller ett subjekt direkt eller indirekt har en andel på 25 procent eller mer av det och det andra företaget.

Tillämpning av undantaget som gäller fristående företag förutsätter att inte ett enda av villkoren i NärSkL 18 b § 2 mom. 1–5 punkten uppfylls. Undantagsbestämmelsen kan därför inte tillämpas till exempel i situationer där företaget för affärsredovisningsändamål inte är medlem i en koncern, men ändå har ett närstående företag som avses i bestämmelsen.

Enligt direktivet avses med en koncern för affärsredovisningsändamål en koncern som består av alla subjekt som är fullt integrerade i den koncernredovisning som upprättats i enlighet med internationella redovisningsstandarder eller nationella finansiella redovisningssystem i en medlemsstat.  Enligt nationella och internationella bokslutsstandarder konsolideras ett bolag i allmänhet i sin helhet i koncernbokslutet i proportion till koncernens ägarandel, då bolag som ingår i samma koncern utövar bestämmande inflytande över bolaget.

Enligt undantagsbestämmelsen kan som fristående företag betraktas endast sådana företag som inte för affärsredovisningsändamål ingår i en koncern och inte har ett fast driftställe i utomlands. Dessutom krävs att företaget varken direkt eller indirekt har en andel i form av rösträtt eller kapitalinnehav motsvarande 25 procent eller mer i ett annat företag eller rätt att motta 25 procent eller mer av vinsterna i det företaget. Som fristående företag betraktas inte heller företag i vars rösträtt, kapital eller vinster en fysisk person eller ett annat företag direkt eller indirekt har en andel på 25 procent eller mer. Om en fysisk person eller ett företag direkt eller indirekt har en andel om 25 procent eller mer av företaget och ett annat eller flera företag, utgör inget av dessa företag fristående företag enligt undantagsbestämmelsen.

Intressegemenskapen på 25 procent som ingår i definitionen av fristående företag kan uppstå både via ett företag och via en fysisk person. Då beaktas utöver den direkta intressegemenskapen även den indirekta. Intressegemenskapen beräknas proportionellt så att man multiplicerar varje mellannivås andel av kapitalet eller rösträtten eller rätten till vinst. Om den sålunda beräknade proportionella andelen är 25 procent eller mer, är det fråga om en intressegemenskap som avses i bestämmelsen. Definitionen av intressegemenskap som ingår i definitionen av fristående företag i undantagsbestämmelsen avviker därmed till vissa delar från definitionen av koncerngemenskap i bestämmelsen om räntebegränsning (se kapitel 3.2.1).

Hur man avgör när det är fråga om ett fristående företag enligt definitionen av intressegemenskap i NärSkL 18 b § 2 mom. beskrivs i följande exempel 1–3, där förutsättningarna för det fristående företaget granskas för företag A.

Exempel 1: A äger direkt 20 procent av B, 15 procent av C och 30 procent av D. A är inte ett fristående företag enligt NärSkL 18 b § 2 mom. 3 punkten, eftersom det direkt äger 30 procent av D.

Exempel 1 i bildform.

Exempel 2: A äger 15 procent av B och 20 procent av C. C äger ytterligare 60 procent av B. A är inte ett fristående företag enligt NärSkL 18 b § 2 mom. 3 punkten eftersom dess totala direkta och indirekta innehav av B är 27 procent.

Exempel 2 i bildform.

Exempel 3: B äger direkt 20 procent av A och 60 procent av C, som äger 15 procent av A. Varken B eller C äger direkt 25 procent eller mer av A. A är inte ett fristående företag enligt NärSkL 18 b § 2 mom. 4 punkten, eftersom B direkt eller indirekt äger 29 procent av A. B kan också vara en fysisk person.

Exempel 3 i bildform.

Om undantaget för fristående företag kan tillämpas avgörs separat för varje skatteår. Tillämpning av undantaget yrkas varje skatteår. Förutsättningen för tillämpning av undantaget är att företaget är ett fristående företag som avses i NärSkL 18 b § 1 mom. 1 punkten under hela skatteåret. Om företaget har varit ett fristående företag som avses i bestämmelsen under hela skatteåret begränsas inte rätten att dra av ränteutgifter under skatteåret enligt NärSkL 18 a § 3 och 4 mom. Företaget kan inte dra av icke avdragsgilla nettoränteutgifter från tidigare år under det skatteår då undantaget för fristående företag tillämpas på företaget.

2.2.2 Finansiella företag

Bestämmelsen om räntebegränsning tillämpas inte på de finansiella företag som finns angivna i NärSkL 18 b § 3 mom. (NärSkL 18 b § 1 mom. 2 punkten). Undantaget som gäller finanssektorn baserar sig på ATAD-direktivet, där de finansiella företag som omfattas av tillämpningsområdet för undantaget angetts.

Enligt NärSkL 18 b 3 mom. avses med finansiella företag i NärSkL 18 b § 1 mom. 2 punkten

  1. kreditinstitut som avses i kreditinstitutlagen;
  2. värdepappersföretag som avses i lagen om investeringstjänster;
  3. förvaltare av alternativa investeringsfonder som avses i lagen om förvaltare av alternativa investeringsfonder (162/2014);
  4. fondbolag som avses i lagen om placeringsfonder (48/1999);
  5. i försäkringsbolagslagen avsedda försäkringsbolag eller återförsäkringsbolag som har koncession;
  6. försäkringsföreningar som avses i lagen om försäkringsföreningar (1250/1987);
  7. i lagen om tilläggspensionsstiftelser och tilläggspensionskassor avsedda tilläggspensionsstiftelser eller tilläggspensionskassor som omfattas av tillämpningsområdet för Europaparlamentets och rådets direktiv (EU) 2016/2341 om verksamhet i och tillsyn över tjänstepensionsinstitut samt i lagen om tilläggspensionsstiftelser och tilläggspensionskassor avsedda kapitalförvaltare;
  8. arbetspensionsanstalter som avses i arbetspensionslagarna och juridiska personer som inrättats i syfte att investera i sådana system;
  9. i lagen om förvaltare av alternativa investeringsfonder avsedda alternativa investeringsfonder för vars förvaltning svarar en i samma lag avsedd förvaltare av alternativa investeringsfonder;
  10. placeringsfonder som avses i lagen om placeringsfonder;
  11. centrala motparter som avses i lagen om värdeandelssystemet och om clearingverksamhet;
  12. värdepapperscentraler som avses i lagen om värdeandelssystemet och om clearingverksamhet.

Med finansiella institut avses bland annat kreditinstitut som avses i kreditinstitutslagen (610/2014), som kan vara antingen inlåningsbanker eller kreditföretag. Bestämmelsen om räntebegränsning tillämpas inte på kreditinstitut som avses i kreditinstitutslagen och som har koncession för kreditinstitutsverksamhet.

Ränteavdragsbestämmelsen tillämpas inte på värdepappersföretag som omfattas av MiFID-reglerna som avses i lagen om investeringstjänster (747/2012) eller på fondföretag som omfattas av UCITS-direktivet som avses i lagen om placeringsfonder (48/1999).

Auktoriserade försäkringsföretag och återförsäkringsföretag enligt Solvens II-direktivet och försäkringsbolagslagen omfattas även av undantaget som gäller finanssektorn. Enligt definitionen i Solvens II-direktivet avses med ett försäkringsföretag ett företag som tillhandahåller direkt liv- eller skadeförsäkring och som har fått auktorisation. En motsvarande definition gäller återförsäkringsföretag. Försäkringsföreningar som avses i lagen om försäkringsföreningar omfattas även av undantaget. Centralskattenämnden ansåg att ett kommanditbolag som bedrev fastighetsplaceringsverksamhet i Finland och som ett utländskt försäkringsbolag investerade i som tyst bolagsman inte var befriat från begränsningen av rätten att dra av räntor enligt tidigare gällande NärSkL 18 a § på basis av det som bestäms i paragrafens 4 mom. (CSN 28/2017).

Som finansiella företag betraktas sådana tilläggspensionsstiftelser och tilläggspensionskassor som avses i lagen om tilläggspensionsstiftelser och tilläggspensionskassor, som utövar tilläggspensionsverksamhet och som inte har befriats från tillämpningsområdet för det så kallade tilläggspensionsdirektivet (2003/41/EG, som omarbetats genom direktiv 2341/2016/EU) genom ett nationellt undantag. I Finland omfattas A-, B- och AB-pensionsstiftelser och -kassor samt tilläggspensionsstiftelser, tilläggspensionskassor och kapitalförvaltare som avses i lagen om tilläggspensionsstiftelser och tilläggspensionskassor av undantaget för finansiella företag, eftersom de uppfyller villkoren i NärSkL 18 b § 3 mom. 7 punkten.  

Pensionsanstalter som omfattas av undantaget är arbetspensionsanstalter som avses i arbetspensionslagarna och som tillhandahåller lagstadgade arbetspensioner, så som arbetspensionsförsäkringsbolag och pensionsstiftelser. Undantaget gäller även juridiska personer som inrättats i syfte att investera i sådana system. Med detta avses till exempel Statens pensionsfond eller dotterbolag som ägs helt av en pensionsanstalt. De sistnämnda är exempelvis fastighetsbolag som ägs av pensionsbolag och investeringar i bolag och olika typer av andra juridiska personer. Undantaget omfattar således investeringsbolag som ägs helt av arbetspensionsbolag, till exempel ömsesidiga fastighetsaktiebolag och bostadsaktiebolag. Undantaget omfattar dock inte sådana bolag som inte i sin helhet ägs av pensionsanstalter ensamma eller tillsammans.

Centralskattenämnden har i sitt förhandsavgörande (CSN 11/2019) ansett att undantaget för finansiella företag tillämpas också på fastighetsbolag, som en i en EU-stat registrerad pensionsanstalt likställd med en inhemsk pensionsanstalt äger direkt eller indirekt.

Förhandsavgörandet gäller en situation där var A Kb ett fastighetsplaceringsbolag som ägde aktiestockarna i Fastighetsaktiebolaget B och Fastighetsaktiebolaget C. De tysta bolagsmännen i A Kb, den inhemska Pensionsanstalten D och den i en annan EU-stat registrerade Pensionsanstalten E, ägde lika stora andelar i A Kb och enligt ansökningshandlingarna bedrev de arbetspensionsförsäkringsverksamhet. A Kb:s enda ansvarige bolagsman var F GP Ab, som också ägdes i lika stora andelar av Pensionsanstalten D och Pensionsanstalten E. Enligt A Kb:s bolagsavtal fördelades bolagets ackumulerade nettointäkter och kapitalåterbäringarna till de tysta bolagsmännen i förhållande till deras bolagsandelar. Fastighetsaktiebolaget B hade från första början ägts av A Kb och bolaget hade även grundats av A Kb. Fastighetsaktiebolaget C hade emellertid förvärvats av A Kb som ett existerande bolag.

Centralskattenämnden ansåg i sitt förhandsavgörande att enligt den redogörelse som lagts fram ägdes A Kb i sin helhet av en arbetspensionsanstalt som avses i NärSkL 18 b § 3 mom. 9 punkten samt en utländsk arbetspensionsanstalt som likställs med den, medan Fastighetsaktiebolaget B och Fastighetsaktiebolaget C var A Kb:s helägda dotterbolag. Avkastningen från A Kb:s verksamhet flöt i sin helhet in till de arbetspensionsanstalter som ägde A Kb. Centralskattenämnden ansåg att A Kb, Fastighetsaktiebolaget B och Fastighetsaktiebolaget C under de förhållanden som beskrivits i ansökan var juridiska personer i enlighet med NärSkL 18 b § 3 mom. 9 punkten och att de hade grundats p.g.a. arbetspensionsanstalternas placeringar. Hur sökandebolagen hade kommit att delvis direkt och delvis indirekt ägas av arbetspensionsanstalterna saknade enligt Centralskattenämnden betydelse i ärendet. Undantaget för finanssektorn omfattar alternativa investeringsfonder, som till sin juridiska form kan vara exempelvis aktiebolag eller kommanditbolag. Bestämmelsen förutsätter att den alternativa investeringsfonden förvaltas av en förvaltare som har registrerats eller som har koncession.

Undantaget för finansiella företag baserar sig enligt direktivet på att varje finansiellt företag självständigt ska uppfylla någon av definitionerna i direktivet. Om företaget inte är ett självständigt finansiellt företag som avses i bestämmelsen, befrias det inte från bestämmelsen om räntebegränsning, även om det hör till en finansiell koncern och är föremål för tillsyn på gruppnivå.

Undantaget för finansiella företag omfattar däremot inte andra moderholdingföretag i en finansiell företagsgrupp, företag som huvudsakligen producerar tjänster och hör till samma koncern som kreditinstitut och vissa finansinstitut, holdingföretag för försäkringsanstalter samt finans- och försäkringskonglomerats holdingsammanslutningar. Undantaget kan heller inte tillämpas på försäkringskassor som avses i lagen om försäkringskassor. Sådana koncernbolag som i huvudsak räknas till andra än faktiska finansiella sammanslutningar omfattas av bestämmelsen om räntebegränsning.

Om undantaget för finansiella företag kan tillämpas avgörs separat för varje skatteår. Tillämpning av undantaget yrkas varje skatteår. Förutsättningen för tillämpning av undantaget är att företaget är ett finansiellt företag som avses i NärSkL 18 b § 1 mom. 2 punkten under hela skatteåret. Om företaget har varit ett finansiellt företag som avses i bestämmelsen under hela skatteåret begränsas inte rätten att dra av ränteutgifter under skatteåret enligt NärSkL 18 a § 3 och 4 mom. Företaget kan inte dra av icke avdragsgilla nettoränteutgifter från tidigare skatteår under det skatteår då undantaget för finansiella företag tillämpas på företaget.

2.2.3 Ränteutgifter i anslutning till finansiering av offentliga infrastrukturprojekt och infrastruktursamfund

Bestämmelsen om räntebegränsning tillämpas inte på lån som används för att finansiera långfristiga offentliga infrastrukturprojekt (NärSkL 18 b § 1 mom. 3 punkten). Tillämpningen av undantaget förutsätter att den projektansvariga, lånekostnader, tillgångar och inkomster finns i Europeiska unionen (NärSkL 18 b § 1 mom. 3 punkten).

Långfristiga offentliga infrastrukturprojekt som avses i undantagsbestämmelsen omfattar social bostadsproduktion, där staten understöder byggande, anskaffning och ombyggnad av hyres- och bostadsrättsbostäder med skäliga boendekostnader avsedda för boende som valts på sociala grunder. Stödet ges som räntestöd för lån som upptagits för detta ändamål. Till räntestödslån hänför sig också alltid statens fyllnadsborgen.

Som ett långsiktigt offentligt infrastrukturprojekt betraktas enligt undantagsbestämmelsen nybyggnad, ombyggnad eller anskaffning av bostäder för vilket det har erhållits lån eller räntestöd med stöd av någon av följande lagar:

  1. lagen om räntestöd för hyresbostadslån och bostadsrättshuslån (29.6.2001/604);
  2. aravalagen (17.12.1993/1189);
  3. Lagen som avses i 2 § 1 mom. 1 punkten i lagen om användning, överlåtelse och inlösen av aravahyresbostäder och aravahyreshus (1190/1993);
  4. lagen om räntestödslån för hyresbostadslån (867/1980);
  5. lagen om räntestöd för bostadsrättshuslån (1205/1993);
  6. lagen om kortvarigt räntestöd för byggnadslån för hyreshus (574/2016).

Med räntestödslån finansieras utöver så kallade vanliga hyres- och bostadsrättsbostäder även byggande, anskaffning och ombyggnad av hyresbostäder för grupper som behöver särskilt stöd. Med räntestödslån finansieras dessutom byggande av bostadsrättshus och produktion av delägarbostäder. Räntestödslån kan beviljas en kommun, ett annat offentligt samfund eller ett allmännyttigt bostadssamfund som ARA med stöd av räntestödslagen har utsett eller ett aktiebolag eller ett bostadsaktiebolag som står under ett sådant samfunds direkta bestämmande inflytande. I subventionerad bostadsproduktion är det inte fråga om ekonomisk verksamhet i vinstdrivande syfte. Räntestödslåntagare är enligt skyldigheten att tillhandahålla allmännyttiga tjänster skyldiga att producera och upprätthålla bostäder enligt systemet. Verksamheten är därmed noggrant reglerad i lag.

I centralskattenämndens förhandsavgörande (CSN 20/2019) hade bolaget med stöd av lagen om kortvarigt räntestöd för byggnadslån för hyreshus (574/2016) fått räntestöd för ett projekt för nybyggnad av bostäder. Dessutom finansierades projektet med ett delägarlån från en aktieägare. Centralskattenämnden ansåg att också ränteutgifter för det offentliga infrastrukturprojektet som orsakades av lånet från en av delägarna var ränteutgifter som avses i NärSkL 18 b § 1 mom. 3 punkten.

Med offentliga infrastruktursamfund i NärSkL 18 b § 1 mom. 3 punkten avses enligt 4 mom. 2 punkten underpunkt a i samma paragraf ett bolag och affärsverk som direkt eller indirekt helt och hållet ägs av staten, en kommun, en samkommun, ett landskap, ett välfärdsområde eller en välfärdsammanslutning, ensam eller tillsammans, och som grundats för innehav och förvaltning av en eller flera vägar, järnvägar, spårvägar, farleder, byggnader eller permanenta konstruktioner eller lösöre med direkt anknytning till dem eller till deras användning.

Dessutom avses med offentliga infrastruktursamfund i NärSkL 18 b § 1 mom. 3 punkten enligt 4 mom. 2 punkten underpunkt b i samma paragraf en samkommun och en välfärdssammanslutning när de äger eller förvaltar egendom som avses i underpunkt a.

Den förteckning över olika infrastrukturer som nämns i paragrafen hindrar inte att den tillämpas även på flera andra typer av infrastruktur, såsom gondolhissar, metro, bergbanor, vatten- och avloppssystem, hamnar och flygfält. Bolagets hela aktiestock ska ägas av offentliga samfund, men innehavet kan också vara indirekt. Detta gör det möjligt att tillämpa bestämmelsen också i situationer där till exempel en kommun har koncentrerat hela sitt fastighetsbolagsinnehav till ett separat bolag.

En förutsättning för tillämpning av undantaget för infrastruktursamfund är enligt motiveringarna till regeringens proposition (RP 211/2021 rd, s. 41) att infrastruktursamfundet överlåter rätten att använda sin egendom till sin ägare eller dennes anknutna enhet för att användas för att sköta dennes offentliga service och dessutom ska bolagets inkomster till väsentlig del bestå av inkomster från överlåtelsen av användningsrätten eller av vederlag från ägaren. Med ägarens anknutna enhet avses en anknuten enhet enligt 15 § i lagen om offentlig upphandling och koncession (1397/2016), som formellt är fristående från den upphandlande enheten och en självständig enhet med avseende på beslutsfattandet, där det inte får finnas andras kapital än de upphandlande enheternas.

Det förutsätts inte att bolagets alla inkomster utgörs av betalningar från ägaren eller dennes anknutna enhet, utan det är möjligt för bolaget att skaffa en liten del av inkomsterna även från tredje parter. Ett bolag som äger till exempel spårvägsinfrastruktur kan även ordna infartsparkering i anslutning därtill, och ta ut parkeringsavgifter av dem som använder parkeringsplatsen. På motsvarande sätt kan ett bolag som äger sjukhusinfrastruktur hyra ut en kafélokal som finns i sjukhusfastigheten till en utomstående som driver kaféet. Dylika inkomstflöden som bolaget har från andra än ägaren eller dennes anknutna enhet ska dock som helhet vara små och ha nära anknytning till användningen av den egentliga infrastruktur som bolaget äger. Det förutsätts inte att samkommunen eller välfärdssammanslutningen överlåter rätten att använda egendomen till ägaren eller dennes anknutna enhet, eftersom samkommuner och välfärdssammanslutningar uttryckligen grundas för att sköta uppgifter som ankommer på kommunerna och välfärdsområdena.

Infrastrukturundantaget som gäller offentliga infrastruktursamfund tillämpas från och med skatteåret 2020. Samfund som omfattas av tillämpningsområdet för undantaget kan ha icke avdragsgilla nettoränteutgifter som uppkommit under skatteåret 2019 eller tidigare. Enligt NärSkL 18 a § 10 mom. får samfund som omfattas av tillämpningsområdet för infrastrukturundantaget dra av icke avdragsgilla nettoränteutgifter som uppkommit före 2020 i deras helhet under skatteåren 2020–2022. De skatteårsspecifika gränserna i NärSkL 18 a § begränsar inte avdragets storlek.

3 Räntetransaktioner som bestämmelsen gäller

3.1 Begreppet ränta vid tillämpning av bestämmelsen

3.1.1 Allmänt om räntorna som bestämmelsen gäller

Med ränteutgift och ränteinkomst avses enligt NärSkL 18 a § 2 mom. ränta och motsvarande andra prestationer som är ersättning för främmande kapital samt prestationer som uppkommer i samband med anskaffning av finansiering. Räntebegreppet i regleringen innefattar betalningar som i beskattnings- och rättspraxis anses utgöra ränta. Vid tillämpning av ränteavdragsbegränsningen har räntebegreppet dock utvidgats, så att det utöver räntebegreppet som annars tillämpas i beskattningen, också omfattar utgifter som uppkommer i samband med anskaffning av finansiering via främmande kapital. Räntebegreppet i regleringen utvidgas ytterligare av att hänsyn ska tas till ATAD-direktivets tolkningsverkan vid bedömningen av räntebegreppet enligt ränteavdragsbegränsningen (se HFD 2021:123).

Regleringen av begränsningen av rätten till ränteavdrag gäller såväl inhemska som gränsöverskridande räntebetalningar. Enligt bestämmelsen beräknas beloppet på de icke avdragsgilla nettoränteutgifterna på basis av företagets nettoränteutgifter, som inkluderar ränteutgifter som betalats till och ränteinkomster som erhållits från både parter som är i koncerngemenskap (nedan också parter i koncerngemenskap) och parter som inte är i koncerngemenskap (nedan också utomstående eller externa parter). Ränteavdragsrätten begränsas dock enligt bestämmelsen delvis på olika sätt beroende på om räntorna betalats till parter i koncerngemenskap eller till externa parter. Därför ska nettoränteutgifter som betalats till parter i koncerngemenskap hållas isär från dem som betalats till externa parter. Hur de icke avdragsgilla nettoränteutgifterna beräknas enligt bestämmelsen behandlas närmare i kapitel 4.

3.1.2 Ersättning för främmande kapital enligt ATAD-direktivet

Regleringen av begränsningen av rätten till ränteavdrag baserar sig på ATAD-direktivet, där räntan som är föremål för regleringen givits en utvidgad definition. Enligt artikel 2.1 i direktivet anses med ersättning för främmande kapital som är föremål för regleringen

  1. räntekostnader för alla former av skuld,
  2. andra kostnader som ekonomiskt motsvarar ränta och kostnader som uppkommer i samband med införskaffandet av kapital, enligt definitionen i nationell rätt, inbegripet men ej begränsat till
  • betalningar avseende vinstandelslån,
  • tillskriven ränta på instrument som konvertibla obligationer och nollkupongsobligationer,
  • belopp enligt alternativa finansieringsarrangemang, till exempel islamisk finansiering,
  • finansieringskostnadsdelen av betalningar av finansiell leasing,
  • kapitaliserad ränta som ingår i balansräkningsvärdet av en därtill relaterad tillgång, eller nedskrivning av kapitaliserad ränta,
  • belopp som i förekommande fall mäts med hänvisning till avkastningen på finansiering inom ramen för internprissättningsregler,
  • belopp av fiktiv ränta inom ramen för derivatinstrument eller säkringsarrangemang med anknytning till ett subjekts lån,
  • vissa utländska valutakursvinster och valutakursförluster på lånat kapital och instrument med anknytning till införskaffandet av kapital,
  • garantiavgifter för finansieringsarrangemang,
  • arrangemangsavgifter och liknande kostnader som gäller upplåning av kapital.

Direktivets inverkan på tolkningen av räntebegreppet har tagits upp i HFD:s årsboksbeslut HFD 2021:123. I situationen enligt beslutet hade A Ab av två kreditbolag tagit lån med en överenskommen tre månaders euribor-ränta som referensränta. A Ab hade med den ena kreditgivaren ingått ett ränteswapavtal enligt vilket A Ab som fast ränta skulle betala en årlig ränta om 0,512 procent och ränteswapavtalets andra part en betalning som baserade sig på en tre månaders euriborränta. Derivatavtalet innehöll ytterligare en floor-bestämmelse. Avsikten med ränteswapavtalet var att skydda A Ab från räntehöjningar. Eftersom referensräntan hade varit negativ skulle A Ab med stöd av ränteswapavtalet ändå utöver den fasta räntan erlägga den negativa rörliga räntan. A Ab hade därtill erlagt en premie på grund av floor-bestämmelsen.

I motiveringen till beslutet konstaterade HFD att det i artikel 2.1 i ATAD-direktivet med bindande verkan för medlemsstaterna föreskrivits vad som avses med ersättning för främmande kapital som omfattas av avdragsbegränsningarna, även om det överlåtits på medlemsstaten att definiera de i bestämmelsen särskilt angivna ersättningarna för främmande kapital.

Högsta förvaltningsdomstolen uttalade att med ränta avses i NärSkL 18 a § 2 mom. utöver ränta också motsvarande andra prestationer som är ersättning för främmande kapital. Med bestämmelsen har från räntebegreppets tillämpningsområde uteslutits ersättningar som betalats för eget kapital.  I bestämmelsen förutsätts inte att ersättningarna som betalats för främmande kapital ska betalas till långivaren för att omfattas av räntebegreppet. I situationen enligt beslutet baserade sig de betalningar som bolaget skulle erlägga med stöd av räntederivatavtalet på en överenskommen räntesats, nominellt kapital och beträffande tiden som förflutit och floor-räntan på en premie. Med beaktande även av direktivets tolkningsverkan ansåg HFD att dessa betalningar var motsvarande andra prestationer som är ersättning för främmande kapital så som avses i NärSkL 18 a § 2 mom. och som ska beaktas i beräkningen av nettoränteutgifterna.

I NärSkL 18 a § 2 mom. har inte särskilt föreskrivits att alla ersättningar för främmande kapital som avses i ATAD-direktivet ska inkluderas i räntebegreppet som omfattas av avdragsbegränsningarna. Enligt motiveringen till högsta förvaltningsdomstolens beslut har i artikel 2.1 i direktivet med bindande verkan för medlemsstaterna däremot föreskrivits vad som avses med ersättningar för främmande kapital som omfattas av avdragsbegränsningarna. Då hänsyn tas till direktivets tolkningsverkan betraktas som ränta som omfattas av avdragsbegränsningarna således förutom betalningar som i beskattnings- och rättspraxis har ansetts utgöra ränta följaktligen även de ersättningar för främmande kapital som anges separat i ATAD-direktivet.

3.1.3 Situationer som tagits upp i beskattnings- och rättspraxis

Som ränta har i beskattnings- och rättspraxis ansetts en ersättning som betalats för främmande kapital och som vanligtvis fastställs som ett visst procentuellt tal utifrån skuldkapitalet och löptiden. Även andra betalningar än de som uppgetts vara ränta kan betraktas som ränta i beskattningen, om deras faktiska ekonomiska karaktär är ersättning för främmande kapital. Begreppet ränta i bestämmelsen om räntebegränsning innefattar bland annat dessa transaktioner som i rätts- och beskattningspraxis ansetts utgöra ränta.

Skuldränta och annan kreditering kan vara en fast årlig ränta eller vara bunden till en allmänt tillämpad referensränta. Ränta på gäld som härrör av näringsverksamhet får dras av, även då räntan är beroende av rörelsens resultat (NärSkL 18 § 1 mom. 2 punkten). Räntan kan därmed också vara bunden till omfattningen på eller resultatet av bolagets verksamhet. I rättspraxis har man ansett att den ränta som ett fondbolag som bedriver riskplacering betalar på vinstberoende lån är avdragsgill (HFD 1992/1910).  På motsvarande sätt har en avkastningsränta som betalats på ett vinstutdelningslån ansetts utgöra ränta (CSN 44/2010). Även en ersättning av engångsnatur som avtalats vid den tidpunkt då skulden uppstod kan betraktas som ränta. I rättspraxis har till exempel en emissionsförlust på obligationslån ansetts utgöra ränta (HFD 1999/330).

Som räntor enligt bestämmelsen om räntebegränsning betraktas räntor som uppkommit under byggnadsfasen för produktion av en helhetstjänst enligt NärSkL 19 a §, vilka periodiseras på det sätt som föreskrivs i NärSkL 27 c § (HFD 2015:37). Periodisering utgör därför inget hinder för att tillämpa bestämmelsen om räntebegränsning då tillämpningsförutsättningarna uppfylls.

Betalningar baserade på leasingavtal har i beskattningen från fall till fall med beaktande av omständigheterna behandlats som ränta eller hyra. I regel har finansiell leasing i beskattningen bedömts utifrån dess juridiska form. En leasingavgift som grundar sig på ett sale and lease back-arrangemang betraktas vid tillämpning av bestämmelsen om räntebegränsning inte som ränta (CSN 25/2013, HFD 29.4.2014 liggare 1443, ingen ändring).

Räntor på konvertibla lån betraktas vanligen som ränteutgifter för låntagaren fram till dess att skuldebrevet konverteras till aktier.

Med nollräntelån avses ett lån på vilket ingen uttrycklig ränta betalas. Ett bolag som placerat i ett lån får en ekonomisk fördel som svarar mot räntan då nollräntelånet emitteras till en kurs som är lägre än det nominella värdet. I rättspraxis (HFD 1986/5699) har man ansett att denna post som motsvarar ränta (differensen mellan skuldebrevets nominella värde och teckningspriset) utgör ränteutgift för emittenten.

Då ett kapitallån som tagits för näringsverksamhet betraktas som främmande kapital utgör den ränta som betalas på kapitallånet ränteutgift för låntagaren.

Indexförluster betraktas inte som ränta då bestämmelsen om ränteavdragsbegränsning tillämpas.

Betalningar som erhålls eller erläggs på basis av räntederivat betraktas vid tillämpningen av ränteavdragsbestämmelsen i regel som ränta (HFD 2021:123).

Definitionen på ränta omfattar inte sådana poster som betalats på kapitalplaceringar som anses utgöra eget kapital i beskattningen. Om ett faktiskt skuldförhållande inte existerar, kan den ersättning som betalas på kapitalet betraktas som annan betalning. Vad gäller ersättning som betalats på olika skuldinstrument i gråzonen mellan främmande kapital och eget kapital avgörs det alltid från fall till fall om den ifrågavarande posten utgör ränta (se till exempel CSN 57/2009). Förutom den bokföringsmässiga behandlingen av instrumentet beaktas också dess ekonomiska karaktär i så fall.

3.1.4 Transaktioner i samband med anskaffning av finansiering

Då bestämmelsen om räntebegränsning tillämpas avses med ränta enligt NärSkL 18 a § 2 mom. utgifter som uppkommer i samband med anskaffning av finansiering via främmande kapital. Dylika kringkostnader och transaktioner i anknytning till upplåning är bland annat garanti- och säkerhetsavgifter samt förrättnings-, hanterings- och förmedlingsavgifter som tas ut för beviljande av lån. Som transaktioner för anskaffning av finansiering anses till exempel bankens sedvanliga uppläggningsarvoden som utgör ersättning för arbetet med att ordna finansieringen. Låneutgifter som har samband med anskaffning av finansiering under lånetiden är också räntor som avses i bestämmelsen, till exempel avgifter som tas ut för ändring av lånevillkoren eller kostnader som tas ut för förtida betalning av lån. På motsvarande sätt anses transaktioner i samband med omstrukturering av finansiering utgöra kostnad för anskaffning av finansiering. Transaktioner i anslutning till anskaffningen av finansiering som anses utgöra ränta är därför inte nödvändigtvis transaktioner av engångsnatur som uppkommit då den ursprungliga skulden togs.

Den faktiska ekonomiska karaktären på transaktionen avgör alltid om den ska betraktas som en transaktion i samband med anskaffning av finansiering som avses i bestämmelsen om räntebegränsning Av den anledningen bedöms transaktionerna fall för fall.

Bestämmelsen begränsar inte avdrag av utgifter som uppkommer vid anskaffning av finansiering via eget kapital, till exempel avdrag av listningsutgifter. Transaktioner i samband med ränteskydd anses i regel inte utgöra transaktioner för anskaffning av finansiering som avses i bestämmelsen. Som ränta betraktas inte heller transaktioner som uppkommer av andra tjänster än låneuppläggning. Exempel på dylika transaktioner är olika rådgivningsarvoden som hänför sig till planeringen av den finansiella strukturen, assistans till ett företag vid företagsköp och när det gäller att ordna finansieringen. De föregår vanligtvis det egentliga låneavtalet och har till denna del inget omedelbart samband med skulden.

3.2 Koncerngemenskapsräntor

3.2.1 Definition av koncerngemenskap

I bestämmelserna om begränsning av rätten till ränteavdrag begränsas avdrag av ränteutgifter som betalats till parter i koncerngemenskap delvis på annat sätt än avdrag av räntor som betalats till utomstående. Av den anledningen ska ränteutgifter som betalats till parter i koncerngemenskap hållas i sär från ränteutgifter som betalats till utomstående.

När man fastställer om koncerngemenskap föreligger granskas det bestämmande inflytandet mellan parterna i skuldförhållandet, dvs. räntebetalaren och mottagaren av ränteinkomst. Parterna är enligt NärSkL 18 a § 6 mom. i en koncerngemenskap med varandra, om den ena parten utövar bestämmande inflytande över den andra parten eller om en tredje part ensam eller tillsammans med närstående kretsar utövar bestämmande inflytande över bägge parter i skuldförhållandet på det sätt som avses i BFL 31 § 4 mom. En tredje part som utövar bestämmande inflytande kan också vara en fysisk person ensam eller tillsammans med närstående kretsar. Med parter som inte är i koncerngemenskap avses parter i ett skuldförhållande mellan vilka förutsättningen för ett sådant bestämmande inflytande som avses i 6 mom. inte uppfylls. Med parter som står i ett skuldförhållande avses i bestämmelserna om begränsning av rätten till ränteavdrag räntebetalaren och den verkliga förmånstagaren till inkomst som motsvarar ränteutgiften.

Med bestämmande inflytande som bildar en koncerngemenskap avses bestämmande inflytande enligt BFL 31 §. Enligt BFL 31 § utövar en part bestämmande inflytande över den andra parten när den ena parten direkt eller indirekt äger mer än hälften av kapitalet i den andra parten eller har mer än hälften av det röstetal som den andra partens samtliga aktier eller andelar medför. Dessutom har en part bestämmande inflytande i en annan part då den har rätt att utse fler än hälften av medlemmarna i den andra partens styrelse eller därmed jämförbart organ. En part utövar bestämmande inflytande över den andra parten även i det fall att ledningen är gemensam med den andra parten eller den ena parten utövar ett faktiskt bestämmande inflytande över den andra parten. Det faktiska bestämmande inflytandet baserar sig alltid på en faktabaserad helhetsbedömning som företas fall för fall. Bestämmande inflytande som avses i BFL 31 § 4 mom. behandlas bland annat i Skatteförvaltningens anvisning Dokumentation av internprissättning.

Definitionen på koncerngemenskap avviker från definitionen på intressegemenskap som ingår i definitionen på fristående företag i NärSkL 18 b § 2 mom., som behandlas i kapitel 2.2.1.

3.2.2 Koncerngemenskapsskulder

3.2.2.1 Direkta och indirekta koncerngemenskapsskulder

I bestämmelserna om begränsning av rätten till ränteavdrag kan en koncerngemenskapsskuld vara antingen direkt eller indirekt.

Med direkt koncerngemenskapsskuld avses en skuld där parterna är i intressemenskap enligt BFL 31 §. Det handlar om direkt koncerngemenskapsskuld till exempel då en part i intressegemenskap lånar vidare en skuld som tagits hos ett externt finansinstitut till en annan part i intressegemenskap.

En skuld anses ha upptagits av en part i koncerngemenskap också då den part som är i koncerngemenskap har en fordran på en part som inte är i koncerngemenskap och fordran har samband med skulden (se kapitel 3.2.2.2). Det handlar om denna typ av indirekt koncerngemenskapsskuld till exempel när den part som är i koncerngemenskap ger en extern part, till exempel ett finansinstitut, en deposition och finansinstitutet lånar medlen till en annan part i koncerngemenskap. En indirekt koncerngemenskapsskuld uppstår också till exempel då säkerheten för ett lån som tagits från ett finansinstitut utgörs av en fordran som innehas av en part i koncerngemenskap (se kapitel 3.2.2.3). Det handlar om en indirekt koncerngemenskapsskuld även i det fall att en fordran som innehas av en part i koncerngemenskap genom flera externa parter har samband med en skuld hos en annan part i koncerngemenskap. Den fordran som avses i bestämmelsen kan vara vilken som helst fordran, till exempel en reversfordran, avbetalningsfordran, hyresfordran, kontofordran eller en fordran som gäller köpeskillingen för aktier.

Således betraktas en skuld enligt NärSkL 18 a § 6–7 mom. som koncerngemenskapsskuld i till exempel följande situationer:

  1. Parterna som är i koncerngemenskap står i ett skuldförhållande sinsemellan (direkt koncerngemenskapsskuld).
  2. Den part som är i koncerngemenskap har en fordran på en part som inte är i koncerngemenskap (extern part) och fordran har samband med skulden (indirekt koncerngemenskapsskuld).
  3. En fordran som innehas av en part i koncerngemenskapen utgör säkerhet för skulden (indirekt koncerngemenskapsskuld).

Räntor som betalats på både direkta och indirekta koncerngemenskapsskulder är enligt NärSkL 18 a § 3 mom. avdragsgilla antingen enligt gränsen på 500 000 euro eller enligt gränsen på 25 procent då förutsättningarna för tillämpningen av bestämmelsen uppfylls. Gränsen på 3 000 000 euro i NärSkL 18 a § 4 mom. och de övriga undantagen i momentet gäller inte koncerngemenskapsräntor. Hur räntorna beräknas enligt gränserna i bestämmelsen behandlas i kapitel 4.

3.2.2.2 Back-to-back-arrangemang

Med en back-to-back-utlåning avses ett finansieringsarrangemang som upprättas genom en part som inte är i koncerngemenskap och där en skuld mellan parter som är i koncerngemenskap har samband med en skuld från en part som inte är i koncerngemenskap. Som back-to-back-utlåning betraktas till exempel ett arrangemang där ett bolag har ett lån från ett externt finansinstitut och ett annat bolag som är i koncerngemenskap med detta bolag deponerar medel till ett motsvarande belopp på ett konto i samma finansinstitut. I arrangemanget kan det externa finansinstitutet debitera ränta från det bolag som är gäldenär och på motsvarande sätt betala ränta på depositionen till det andra bolaget.

Exempel 4: A har en skuld hos det externa finansinstitutet Y. Bolag B som är i koncerngemenskap med bolag A har deponerat medlen hos det externa finansinstitutet X. Därefter har finansinstitutet X överfört medlen till finansinstitutet Y. A och B som är i koncerngemenskap har inget skuldförhållande, men på grund av B:s fordran hos X och X:s fordran hos Y anses skulden mellan A och det externa finansinstitutet Y utgöra en koncerngemenskapsskuld för A. Det är inte av betydelse att det samband som koncerngemenskapspart B:s fordran har med koncerngemenskapspart A:s skuld uppstår genom de två externa finansinstituten X och Y.

Exempel 4 i bildform.

Vid back-to-back-utlåning står parterna i koncerngemenskap inte i ett skuldförhållande sinsemellan, men den faktiska förmånstagaren av den inkomst som motsvarar ränteutgift i arrangemanget är dock i koncerngemenskap med det bolag som är gäldenär. Av denna anledning utgör räntor på back-to-back-skulder sådana räntor som betalats till parter i koncerngemenskap som avses i bestämmelsen.

En fordran som en part i koncerngemenskap har på en extern part leder till att det lån som den externa parten gett en annan part i koncerngemenskap blir en koncerngemenskapsskuld då fordran har samband med skulden. Till exempel en skuld som tagits hos ett finansinstitut betraktas som en koncerngemenskapsskuld då en part i koncerngemenskap deponerat medlen för att finansinstitutet skall kunna låna medlen till en annan part i koncerngemenskap. Fordran kan ha samband med en skuld till exempel i ett arrangemang som påverkat villkoren för ett lån som en extern part har gett en annan part i koncerngemenskap. Ett lån som en extern part har gett kan betraktas som en koncerngemenskapsskuld även då fordran som innehas av parten i koncerngemenskap och lånet har ett tidsmässigt samband.

En skuld som tagits hos en extern part betraktas som en koncerngemenskapsskuld till den del som fordran som innehas av parten i koncerngemenskap har samband med skulden.

3.2.2.3 Säkerheter

En säkerhet leder till att en skuld som tagits från en annan part än en part i koncerngemenskap betraktas som en koncerngemenskapsskuld, om säkerheten för skulden utgörs av en fordran som innehas av en part i koncerngemenskap.  En skuld som i detta sammanhang tagits från en extern part betraktas som koncerngemenskapsskuld och de betalda räntorna som koncerngemenskapsräntor som avses i bestämmelsen om räntebegränsning.

Exempel 5: A har en skuld hos det externa finansbolaget Y. Bolag B som är i koncerngemenskap med bolag A har givit en kontofordran som säkerhet för A:s lån till finansbolaget. A och B som är i koncerngemenskap har inget skuldförhållande, men på grund av B:s kontofordran som utgör säkerhet för skulden betraktas skulden mellan A och det externa finansbolaget Y som en koncerngemenskapsskuld.

Exempel 5 i bildform.

En skuld som tagits av en extern part betraktas som en koncerngemenskapsskuld till den del som fordran som innehas av en part i koncerngemenskap står som säkerhet för skulden.

3.2.3 Cash pooling-arrangemang

Cash pooling är ett koncernkontoarrangemang där koncernens penningflöde antingen fysiskt eller kalkylmässigt styrs till ett koncernkonto. Flera olika cash pooling-modeller används.

Räntor som betalats till en part som är i koncerngemenskap uppstår enligt bestämmelsen om räntebegränsning i sådana cash pooling-arrangemang där bolagens medel fysiskt överförs till huvudkontot, dvs. koncernkontot. Medlen kan överföras till huvudkontot till exempel dagligen eller alternativt röra sig mellan huvudkontona och underkontona då vissa gränser uppnås. Eftersom bolagens medel överförs fysiskt från deras egna konton till koncernkontot vid sådana arrangemang, är de kontoskulder som anknyter till arrangemanget följaktligen koncerngemenskapsskulder, och de betalda ränteutgifterna koncerngemenskapsräntor.

Även i sådana cash pooling-arrangemang där cash pool-medlen står i respektive koncernbolags namn och upptagits i deras bokföring, kan koncerngemenskapsskulder uppkomma, då kontotillgångarna för bolag som ingår i arrangemanget pantsatts som säkerhet för arrangemanget. Då en fordran som innehas av en part i koncerngemenskap står som säkerhet för ett sådant cash pooling-arrangemang, kan de räntor som omfattas av arrangemanget betraktas som koncerngemenskapsräntor, som bestämmelsen om räntebegränsning tillämpas på.

Skulder som tagits av en part i koncerngemenskap uppstår inte i cash pooling-situationer, om cash pooling-medlen fortfarande står i respektive koncernbolags namn och upptagits i deras bokföring. Med detta avses i första hand sådana cash pooling-arrangemang där saldona för kontofordringarna och -skulderna utjämnas kalkylmässigt utan överföring av fysiska medel. I detta fall finns medlen för de bolag som ingår i arrangemanget fortfarande på respektive bolags eget bankkonto, och inget skuldförhållande uppstår. Även i dessa situationer kan en fordran som innehas av en part i koncerngemenskap vilken står som säkerhet för cash pooling-arrangemangen ändra de kontoskulder som hör till arrangemanget till koncerngemenskapsskulder och tillhörande räntor till koncerngemenskapsräntor, som bestämmelsen om räntebegränsning tillämpas på.

3.2.4 Situationer då det inte är fråga om koncerngemenskapsskuld

Med parter som inte är i koncerngemenskap avses parter i ett skuldförhållande mellan vilka förutsättningen för ett sådant bestämmande inflytande som avses i NärSkL 18 a § 6 mom. inte uppfylls.

En skuld som ett bolag tagit hos ett finansinstitut betraktas inte som en koncerngemenskapsskuld enbart på grund av att ett bolag som är i koncerngemenskap har depositioner i samma finansinstitut. Koncerngemenskapsskulderna omfattar inte heller sådana banklån som inte har samband med en bankfordran som en annan part i koncerngemenskap har eller en säkerhet som getts till en bank.

En fordran som en part i koncerngemenskap har på en extern part för ett obligationslån som erbjuds till allmänheten leder i allmänhet inte till att ett lån som denna externa part gett en part som är i koncerngemenskap blir en koncerngemenskapsskuld. I detta fall har bolaget en obligationsfordran på den externa parten som lånar medel till ett annat bolag som är i koncerngemenskap med det bolag som tecknat obligationslånet.

Att regleringen för indirekta koncerngemenskapsskulder avgränsats till fordringar innebär till exempel att aktier i ett bolag som tagit en skuld hos en extern part vilka ställs som säkerhet för skulden inte gör att skulden är skuld som tagits av en part i koncerngemenskap. På motsvarande sätt medför inte garantier som ett företag i koncerngemenskap gett som säkerhet för en skuld som tagits hos en extern part att lånet tagits av en part som är i koncerngemenskap.

En företagsinteckning som fastställts som säkerhet för en skuld som tagits hos en extern part gör vanligen inte skulden till en koncerngemenskapsskuld.

Som koncerngemenskapsskuld betraktas i regel heller inte skuld som erhållits av parter som äger lika stora andelar i den skattskyldige via ett samföretag. I högsta förvaltningsdomstolens årsboksbeslut HFD 2021:123 var det fråga om en situation där A Ab var ett bolag som förvaltade fastighetsinvesteringar och vars alla aktier ägdes av svenska B AB. Sammanlagt 50 procent av aktierna i B AB ägdes av luxemburgska C S.A. och 50 procent av luxemburgska D S.à r.l. B AB var ett samföretag (joint venture) som ägdes av delägarna.  Enligt ett samföretagsavtal mellan bolagen 2017 ledde och förvaltade C S.A. och D S.à r.l. tillsammans A Ab via B AB.

De från varandra oberoende luxemburgiska bolagen C S.A. och D S.à r.l. hade finansierat A Ab:s verksamhet med lika stora andelar främmande kapital. Enligt ett samföretagsavtal mellan C S.A. och D S.á r.l. har dessa en lika stor representation i B AB:s styrelse vars medlemmar inom sig utser en styrelseordförande. Ordföranden har inte avgörande rösträtt i röstningssituationer. Om rösterna faller lika och aktieägarna inte kan enas, fortskrider aktieägarna till ett inlösningsförfarande enligt samföretagsavtalet för att avtala om upplösning av samföretaget.

HFD konstaterade i motiveringen till beslutet att av förarbetena till BFL 31 § 2 mom., som ska tillämpas i situationen, framgår att en gemensam ledning som avses i 4 punkten i nämnda bestämmelse också förutsätter bestämmande inflytande. Då ingendera aktieägaren i B AB hade bestämmande inflytande i vare sig B AB eller A Ab, var räntorna på de lån som A Ab fått av aktieägarna i B AB enligt 18 a § 4 mom. 2 punkten a underpunkten i lagen om beskattning av inkomst av näringsverksamhet inte betalade till parter i koncerngemenskap.

3.3 Övergångsbestämmelse för räntor som inte utgör koncerngemenskapsräntor

Nettoränteutgifter som betalats till parter som inte är i koncerngemenskap är enligt NärSkL 18 a § 4 mom. 2 punkten avdragsgilla till den del den skattskyldige lägger fram en utredning om att nettoränteutgifterna

  1. uppkommer för lån som har upptagits före den 17 juni 2016 och som inte bygger på sådana ändringar i lånevillkoren som gäller en ökning av lånebeloppet eller lånetiden och som har gjorts nämnda datum eller därefter;
  2. med stöd av 14 § räknas som anskaffningsutgift för tillgångar före den 1 januari 2019;
  3.  med stöd av 23 § har aktiverats före den 1 januari 2019; eller
  4. med stöd av 27 c § har aktiverats före den 1 januari 2019.

För att bestämmelsen som gäller så kallade gamla skulder som avses i NärSkL 18 a § 4 mom. 2 punkten underpunkt a ska kunna tillämpas förutsätts att skulden upptagits före den 17 juni 2016. Med detta avses skulder som det har avtalats om bindande och som ska ha kunnat upptas innan nämnda tidpunkt. Enligt finansutskottets betänkande (FiUB 21/2018 rd) hindrar inte det att någon del av lånet upptagits senare tillämpning av 2 punkten underpunkt a. Om ett låneavtal har ingåtts bindande före den 17 juni 2016 uppfyller det enligt det som framförs i finansutskottets betänkande tillämpningsvillkoren i övergångsbestämmelsen, även om lånet upptagits delvis eller i sin helhet vid en senare tidpunkt.

Punkt 2 underpunkt a i övergångsbestämmelsen kan enligt regeringens proposition (RP 150/2018 rd) tillämpas på ränteutgifter endast upp till det belopp som finns angivet i lånevillkoren som varit i kraft före den 17 juni 2016. Bestämmelsen tillämpas inte på ränteutgifter till den del de bygger på ändringar i lånevillkoren som har trätt i kraft under nämnda tidpunkt eller senare. Med en ändring av lånevillkoren avses i bestämmelsen ändringar som leder till en ökning av lånebeloppet eller en förlängning av lånetiden. Som en sådan ändring av lånevillkoret som avses i paragrafen betraktas exempelvis inte en ändring av referensräntan för lånet eller en ändring av tidpunkten då amorterings- eller ränteposterna förfaller, om inte lånetiden eller lånebeloppet ändras. Ränta som betalas på obetald ränta med anledning av räntekapitalisering omfattas av övergångsbestämmelsen, då räntekapitaliseringen baserar sig på ett lån som avtalats före den 17 juni 2016 och på lånevillkor som varit i kraft innan denna tidpunkt.

Centralskattenämnden ansåg i sitt förhandsavgörande (CSN 4/2022) att lånen som A Ab ursprungligen tagit av F S.à r.l samt C S.A med samma låneavtal inte skulle bedömas som nya lån då bestämmelsen tillämpades endast av den anledningen att den ena borgenären i låneavtalet hade bytts ut enligt ett avtal som ingåtts 2017. Centralskattenämnden motiverade sitt avgörande med att överföring av en lånefordran från en borgenär till en annan i regel kan ske med borgenärens ensidiga anmälan, och att det varken i ordalydelsen i 18 a § 4 mom. 2 punkten underpunkt a i lagen om beskattning av inkomst av näringsverksamhet eller i förarbetena till lagen hänvisas till att överföring av fordran skulle hindra tillämpning av bestämmelsen. Då det till lånevillkoren i låneavtalet som A Ab ursprungligen ingått år 2014 inte gjorts ändringar avseende lånebelopp eller löptid 17 juni 2016 eller senare, ansåg centralskattenämnden att bestämmelsen i 18 a § 4 mom. 2 punkten underpunkt a i lagen om beskattning av inkomst av näringsverksamhet kunde tillämpas på nettoränteutgifterna som uppstod för lånen ifråga i de omständigheter som beskrivs i ansökan.

Enligt övergångsbestämmelsen tillämpas bestämmelserna om begränsning av rätten till ränteavdrag heller inte på ränteutgifter som betalats till parter som inte är i koncerngemenskap och som har aktiverats enligt NärSkL 18 a § 4 mom. 2 punkten underpunkterna b–d före den 1 januari 2019.

Den skattskyldige ska på begäran ge en utredning över hur villkoren för tillämpningen av övergångsbestämmelsen uppfylls.

Centralskattenämnden ansåg i sitt förhandsavgörande (CSN 49/2019), att ett kraftverksprojekts räntekostnader under byggtiden inkluderades i anskaffningsutgiften för anläggningen, och att de var avdragsgilla enligt NärSkL 18 a § 4 mom. 2 punkten underpunkt b. I förevarande fall hade A Ab börjat bygga ett nytt kraftverk under 2015 och avsikten var att ta kraftverket i drift under 2019. A Ab hade under räkenskapsperioderna 2016–2018 i sin bokföring aktiverat räntekostnader som hänför sig till byggandet av kraftverket. P.g.a. att projektet inte var slutfört hade räntekostnaderna registrerats i pågående anskaffningar. A Ab hade för avsikt att på basis av BokfL 4 kap. 5 § inkludera räntekostnaderna under byggtiden i anskaffningsutgiften efter det att kraftverket tagits i bruk under skatteåret 2019.

I och med att kraftverksprojektets räntekostnader under byggtiden inte hade dragits av i bokföringen på det sätt som beskrivits i ansökan, ansåg centralskattenämnden att det var fråga om räntekostnader som i beskattningen ansågs ingå i anskaffningsutgiften med stöd av NärSkL 14 § 1 mom. Under de omständigheter som beskrivs i ansökan var nettoränteutgifterna på lån som tagits efter 17.6.2016, och som var större än det i NärSkL 18 a § 4 mom. 1 punkten avsedda procentbaserade beloppet och gränsen på 3 000 000 euro och som betalats till parter som inte är i koncerngemenskap, avdragsgilla i Ab:s beskattning med stöd av NärSkL 18 a § 4 mom. 2 punkten underpunkt b i form av avskrivning på utgiftsresten för tillgångarna till den del som räntorna i bokföringen hade aktiverats i pågående anskaffningar innan 1.1.2019.

4 Beräkning av avdragsgilla ränteutgifter

4.1 Om nettoränteutgifter

Enligt bestämmelsen om räntebegränsning baserar sig beräkningen av avdragsgilla och icke avdragsgilla ränteutgifter på nettoränteutgifter, varmed avses ränteutgifter som överstiger ränteinkomsterna. Nettoränteutgifter uppkommer då ränteutgifterna överstiger ränteinkomsterna under skatteåret.

I nettoränteutgifterna inkluderas i regel alla ränteutgifter och ränteinkomster den skattskyldige haft under skatteåret. I nettoränteutgifterna inkluderas också ränteutgifterna och ränteinkomsterna som avses i övergångsbestämmelsen i NärSkL 18 a § 4 mom. 2 punkten.

Nettoränteutgifterna omfattar såväl nettoränteutgifter som betalats till parter som är i koncerngemenskap (nedan nettoränteutgifter som betalats till parter i koncerngemenskap) samt nettoränteutgifter som betalats till parter som inte är i koncerngemenskap (nedan nettoränteutgifter som betalats till utomstående eller externa parter). Med nettoränteutgifter som betalats till parter i koncerngemenskap avses differensen mellan ränteutgifterna som betalats till parter i koncerngemenskap och ränteinkomsterna som erhållits av parter i koncerngemenskap under skatteåret. Med nettoränteutgifter som betalats till externa parter avses differensen mellan ränteutgifterna som betalats till externa parter och ränteinkomsterna som erhållits av externa parter under skatteåret. Enligt bestämmelsen om räntebegränsning dras nettoränteutgifterna delvis av på olika sätt för parter i koncerngemenskap och externa parter, varför dessa bör hållas i sär vid beräkningen.

Exempel 6: Företagets nettoränteutgifter under skatteåret är 4 000 000 euro, varav

  • 2 600 000 euro har betalats i ränteutgifter till parter i koncerngemenskap och 1 500 000 euro erhållits i ränteinkomster från parter i koncerngemenskap
  • 3 000 000 euro har betalats i ränteutgifter till externa parter och 100 000 euro erhållits i ränteinkomster från externa parter.

Nettoränteutgifterna som företaget har betalat till parter i koncerngemenskap är 1 100 000 euro (2 600 000 euro - 1 500 000 euro) och nettoränteutgifterna som företaget betalat till externa parter är 2 900 000 euro (3 000 000 euro -100 000 euro).

För att alla ränteinkomster ska bli beaktade i beräkningen av nettoränteutgifterna på det sätt som avses i bestämmelsen om räntebegränsning, kan de ränteinkomster som erhållits från parter i koncerngemenskap som överstiger ränteutgifterna som betalats till parter i koncerngemenskap beaktas som avdrag från nettoränteutgifterna som betalats till externa parter. Om ränteinkomsterna som erhållits av externa parter överstiger ränteutgifterna som betalats till externa parter, kan de ränteinkomster som överstiger ränteutgifterna beaktas som avdrag från nettoränteutgifterna som betalats till parter i koncerngemenskap.

Exempel 7: Företagets nettoränteutgifter under skatteåret är 600 000 euro, varav

  • 600 000 euro har betalats i ränteutgifter till parter i koncerngemenskap och 5 000 000 euro erhållits i ränteinkomster från parter i koncerngemenskap
  • 5 000 000 euro har betalats i ränteutgifter till externa parter och inga ränteinkomster alls erhållits från externa parter.

Om man räknar enligt huvudregeln har företaget under skatteåret erhållit ränteinkomster från parter i koncerngemenskap som är 4 400 000 euro större än ränteutgifterna som företaget betalat till parter i koncerngemenskap. Dessutom har företaget betalat 5 000 000 euro i nettoränteutgifter till  externa parter. Eftersom ränteinkomsterna som företaget erhållit från parter i koncerngemenskap överstiger ränteutgifterna som betalats till parter i koncerngemenskap, kan den del av ränteinkomsterna som överstiger ränteutgifterna som betalats till parter i koncerngemenskap beaktas som avdrag från nettoränteutgifterna som betalats till externa parter. Således har företaget inga nettoränteutgifter som betalats till parter i koncerngemenskap under skatteåret (600 000 euro - 600 000 euro = 0) men nog 600 000 euro (5 000 000 euro - 4 400 000 euro = 600 000 euro) i nettoränteutgifter som betalats till externa parter.

Nettoränteutgifter som betalats till externa parter är alltid avdragsgilla om de består av ränteutgifter som omfattas av övergångsbestämmelsen (NärSkL 18 a § 4 mom. 2 punkten). Av den anledningen ska ränteutgifter på skulder som avses i övergångsbestämmelsen följas upp som en egen post bland de nettoränteutgifter som betalats till parter som inte är i koncerngemenskap.

4.2 Gränserna för beräkning av avdragsgilla ränteutgifter

Enligt NärSkL 18 a § 3 mom. är ränteutgifter som överstiger ränteinkomsterna alltid avdragsgilla om de under skatteåret uppgår till högst 500 000 euro (den så kallade gränsen på 500 000 euro). Överstiger nettoränteutgifterna 500 000 euro är de inte avdragsgilla till den del de överstiger 25 procent av det så kallade justerade resultatet (den så kallade gränsen på 25 procent). Nettoränteutgifter som betalats till externa parter är däremot enligt 18 a § 4 mom. 1 punkten i NärSkL alltid avdragsgilla upp till 3 000 000 euro (den så kallade gränsen på 3 000 000 euro). Ränteutgifter som betalats till externa parter på skulder som avses i övergångsbestämmelsen i NärSkL 18 a § 4 mom. 2 punkten är dock avdragsgilla även då de på basis av ovanstående gränser inte vore avdragsgilla.

För samma skatteår kan man inte tillämpa gränserna på både 3 000 000 euro och 25 procent. Gränsen på 3 000 000 euro tillämpas endast om de icke avdragsgilla nettoränteutgifterna enligt den är mindre än om gränsen på 25 procent hade tillämpats.

De nettoränteutgifter som betalats till externa parter dras enligt NärSkL 18 a § 3 mom. alltid av först. Därefter kan nettoränteutgifter som betalats till parter i koncerngemenskap dras av, om den tillämpade avdragsgränsen det medger.

Hur tidigare års icke avdragsgilla nettoränteutgifter dras av under skatteåret behandlas i kapitel 5.

Flödesplanen nedan beskriver hur de avdragsgilla nettoränteutgifterna beräknas enligt bestämmelsen om räntebegränsning. Undantagen i NärSkL 18 b § har inte beaktats.

Flödesplan som beskriver hur de avdragsgilla ränteutgifterna under skatteåret beräknas

4.3 Nettoränteutgifterna under skatteåret högst 500 000 euro

Rätten att avdra ränteutgifter under skatteåret begränsas enligt NärSkL 18 a § 3 mom. inte då nettoränteutgifterna under skatteåret uppgår till högst 500 000 euro. Då gränsen på 500 000 euro beaktas behandlas nettoränteutgifter som betalats till parter i koncerngemenskap och externa parter som en post.

Exempel 8: Nettoränteutgifterna under skatteåret är totalt 500 000 euro, varav:

  • 400 000 euro har betalats till parter i koncerngemenskap
  • 100 000 euro har betalats till externa parter.

Rätten att dra av ränteutgifter begränsas inte under skatteåret eftersom totalbeloppet av nettoränteutgifterna som betalats till parter i koncerngemenskap och externa parter inte överstiger 500 000 euro. Därför är ränteutgifterna som betalats till både parter i koncerngemenskap och externa parter avdragsgilla.

4.4 Nettoränteutgifterna under skatteåret överstiger 500 000 euro

4.4.1 Allmänt

Överstiger nettoränteutgifterna 500 000 euro är de enligt NärSkL 18 a § 3 mom. inte avdragsgilla till den del de överstiger 25 procent av det så kallade justerade resultatet. Den icke avdragsgilla andelen bestäms då gränsen på 25 % tillämpas endast enligt en procentbaserad gräns. Tillämpningen av en procentbaserad gräns kan därför leda till att beloppet av de avdragsgilla nettoränteutgifterna är mindre än 500 000 euro. Nettoränteutgifter som betalats till externa parter är enligt NärSkL 18 a § 4 mom. 1 punkten däremot alltid avdragsgilla upp till 3 000 000 euro.

På nettoränteutgifter som betalats till externa parter kan 3 000 000 euro därför dras av, även om det avdragsgilla beloppet enligt gränsen på 25 procent vore mindre. Om det avdragsgilla beloppet enligt gränsen på 25 procent är större än 3 000 000 euro, kan avdraget göras enligt gränsen på 25 procent. Undantaget på 3 000 000 euro för nettoränteutgifter som betalats till externa parter tillämpas endast om det belopp som ska dras av med stöd av den gränsen är större än beloppet som skulle dras av enligt gränsen på 25 procent. Om gränsen på 3 000 000 euro tillämpas under skatteåret, kan ränteutgifterna inte dras av enligt gränsen på 25 procent under det skatteåret.

Rätten att dra av ränteutgifter begränsas således antingen enligt gränsen på 25 procent eller för nettoränteutgifter som betalats till externa parter enligt gränsen på 3 000 000 euro. Innan man kan fastställa gränsen som ska tillämpas på nettoränteutgifterna och ränteutgifternas avdragsgilla belopp under skatteåret beräknas först ett så kallat justerat resultat för den skattskyldige. Därefter jämför man det belopp som 25 procent av det justerade resultatet utgör med nettoränteutgifterna som betalats till externa parter och 3 000 000 euro. Utifrån jämförelsen fastställer man på det sätt som beskrivs nedan i vilken omfattning ränteutgifterna är avdragsgilla under skatteåret.

4.4.2 Justerat resultat

Bestämmelsen om räntebegränsning gäller ränteutgifter i förvärvskällorna för näringsverksamhet, annan verksamhet och jordbruk. Grunden för det justerade resultatet enligt NärSkL 18 § 3 mom. är näringsverksamhetens resultat enligt NärSkL 3 §, varmed avses skillnaden mellan alla skattepliktiga intäkter och avdragsgilla kostnader enligt NärSkL under skatteåret före avdrag av fastställda förluster från tidigare år.

Vid beräkning av det justerade resultatet läggs alla ränteutgifter, inklusive de utgifter som uppkommer i samband med anskaffning av finansiering som enligt NärSkL 18 a § 2 mom. betraktas som ränta, och avskrivningar som ska dras av i beskattningen till resultatet av näringsverksamheten. Ränteutgifterna anges till bruttobelopp. Från ränteutgifterna görs således inte avdrag för ränteinkomster eller belopp som vid tillämpning av bestämmelsen om räntebegränsning eventuellt inte är avdragsgilla. Som ränteutgifter som ska läggas till då man beräknar det justerade resultatet av näringsverksamheten beaktas även ränteutgifter för så kallade gamla skulder och ränteutgifter som aktiverats med stöd av NärSkL 14 §, 23 § och 27 c § under det skatteår då de dras av till exempel i form av avskrivningar eller anskaffningsutgift (NärSkL 18 a § 4 mom. 2 punkten).

Till näringsverksamhetens resultat läggs också mottagna koncernbidrag och från resultatet avdras beviljade koncernbidrag enligt lagen om koncernbidrag vid beskattningen (825/1986) som inte ingår i resultatet av näringsverksamheten enligt NärSkL 3 §. Bassamfundsinkomst räknas inte in i näringsverksamhetens resultat. Det justerade resultatet beräknas följaktligen genom att man justerar skillnaden mellan intäkterna och kostnaderna enligt NärSkL 3 § på följande sätt:

Resultat av näringsverksamheten enligt NärSkL 3 §

+ ränteutgifter (brutto)

+ avskrivningar som dras av i beskattningen

+ mottagna koncernbidrag

- givna koncernbidrag

- koncernavdrag

= Justerat resultat

Om den skattskyldige har andra förvärvskällor än förvärvskällan för näringsverksamhet utgör det justerade resultatet det sammanlagda beloppet av resultatet av förvärvskällorna för näringsverksamhet, jordbruk och annan verksamhet (NärSkL 18 a § 5 mom.). Det sammanlagda beloppet justeras på motsvarande sätt som ovan med beaktande av ränteutgifterna och avskrivningarna i förvärvskällorna för jordbruk och annan verksamhet.

Exempel 9: Företagets resultat av näringsverksamheten före koncernbidrag är -550 000 euro. Företaget har betalat 700 000 euro i ränteutgifter till parter i koncerngemenskap och erhållit 100 000 euro i ränteinkomster från parter i koncerngemenskap. Dessutom har företaget betalat totalt 500 000 euro i ränteutgifter till externa parter, varav 200 000 euro betalats på så kallade gamla skulder. Företaget har gjort avskrivningar på totalt 850 000 euro i beskattningen. Företaget har under skatteåret fått 1 000 000 euro i koncernbidrag.

Företaget har dessutom en förvärvskälla för annan verksamhet, där resultat är 5 000 euro. I förvärvskällan för annan verksamhet har företaget 6 000 euro i ränteutgifter som betalats till externa parter. Företaget har i beskattningen gjort avskrivningar på 20 000 euro på tillgångarna i den aktuella förvärvskällan.

Företagets justerade resultat beräknas på följande sätt:

NärSkL-resultat (NärSkL 3 §) -550 000 euro

+ ISkL-resultat 5 000 euro

+ NärSkL-ränteutgifter 1 200 000 euro

+ ISkL-ränteutgifter 6 000 euro

+ avskrivningar i NärSkL- och ISkL-förvärvskällorna i beskattningen totalt 870 000 euro

+ mottaget koncernbidrag 1 000 000 euro

= justerat resultat 2 531 000 euro

Det justerade resultatet multipliceras med 25 procent, som nettoränteutgifterna under skatteåret jämförs med. Vid beräkningen måste det justerade resultatet vara positivt. Är det justerade resultatet negativt är 25 procent av det justerade resultatet 0,00 euro.

4.4.3 Tillämpning av gränsen på 25 procent

Rätten att dra av ränteutgifter under skatteåret begränsas inte om nettoränteutgifterna under skatteåret uppgår till högst 25 procent av det justerade resultatet.

Exempel 10: Nettoränteutgifterna under skatteåret är totalt 1 300 000 euro, varav:

  • 600 000 euro har betalats till parter i koncerngemenskap
  • 700 000 euro har betalats till externa parter.

25 procent av det justerade resultatet är 1 500 000 euro. Av nettoränteutgifterna under skatteåret är 1 300 000 euro avdragsgilla. Rätten att avdra ränteutgifter begränsas således inte under skatteåret.

Om nettoränteutgifterna som betalats till externa parter uppgår till högst 25 procent av det justerade resultatet, tillämpas gränsen på 25 procent. Nettoränteutgifterna som betalas till externa parter är då i sin helhet avdragsgilla och nettoränteutgifterna som betalats till parter i koncerngemenskap icke avdragsgilla till den del det totala beloppet av nettoränteutgifterna som betalats till externa parter och parter i koncerngemenskap överstiger 25 procent av det justerade resultatet. Eftersom ränteutgifterna som betalats till externa parter således i sin helhet är avdragsgilla enligt gränsen på 25 procent, tillämpas inte gränsen på 3 000 000 euro under skatteåret.

Exempel 11. Nettoränteutgifterna under skatteåret är totalt 4 500 000 euro, varav:

  • 1 600 000 euro har betalats till parter i koncerngemenskap
  • 2 900 000 euro har betalats till externa parter.

25 procent av det justerade resultatet är 3 200 000 euro. Eftersom nettoränteutgifterna som betalats till externa parter inte överskrider 25 procent av det justerade resultatet, är nettoränteutgifterna som betalats till externa parter i sin helhet avdragsgilla. Av nettoränteutgifterna som betalats till parter i koncerngemenskap är 1 300 000 euro icke avdragsgilla.

Gränsen på 25 procent tillämpas under skatteåret också då 25 procent av det justerade resultatet är större än 3 000 000 euro och då nettoränteutgifterna som betalats till externa parter är större än 25 procent av det justerade resultatet. Icke avdragsgilla är då nettoränteutgifter som betalas till externa parter, till den del de överstiger 25 procent av det justerade resultatet. Eftersom man i första hand drar av nettoränteutgifterna som betalats till externa parter och beloppet på dem överstiger 25 procent av det justerade resultatet, kan nettoränteutgifterna som betalats till parter i koncerngemenskap således inte dras av över huvud taget. I sådana situationer tillämpas inte gränsen på 3 000 000 euro, för inom ramen för gränsen på 25 procent dras mer än 3 000 000 euro av i nettoränteutgifter som betalats till externa parter.

Exempel 12. Nettoränteutgifterna under skatteåret är totalt 5 000 000 euro, varav:

  • 1 000 000 euro har betalats till parter i koncerngemenskap
  • 4 000 000 euro har betalats till externa parter.

25 procent av det justerade resultatet är 3 500 000 euro. I nettoränteutgifter dras 3 500 000 euro av enligt gränsen på 25 procent. Alla nettoränteutgifter som betalats till parter i koncerngemenskap är icke avdragsgilla liksom också 500 000 euro av nettoränteutgifterna som betalats till externa parter.

4.4.4 Tillämpning av gränsen på 3 000 000 euro

Gränsen på 3 000 000 euro tillämpas under skatteåret då nettoränteutgifterna som betalats till externa parter är större än 25 procent av det justerade resultatet och då 25 procent av det justerade resultatet är mindre än 3 000 000 euro. Då är nettoränteutgifterna som betalats till externa parter avdragsgilla upp till 3 000 000 euro och nettoränteutgifterna som betalats till parter i koncerngemenskap kan inte dras av över huvud taget. I sådana situationer tillämpas inte gränsen på 25 procent, för om den tillämpas blir beloppet på de avdragsgilla nettoränteutgifterna lägre än om gränsen på 3 000 000 euro hade tillämpats.

Exempel 13: Nettoränteutgifterna under skatteåret är totalt 1 500 000 euro, varav:

  • 500 000 euro har betalats till parter i koncerngemenskap
  • 1 000 000 euro har betalats till externa parter.

25 procent av det justerade resultatet är 0,00 euro.

Av nettoränteutgifterna som betalats till externa parter dras 1 000 000 euro av enligt gränsen på 3 000 000 euro. Nettoränteutgifterna som betalats till parter i koncerngemenskap kan inte dras av över huvud taget.

Exempel 14. Nettoränteutgifterna under skatteåret är totalt 5 000 000 euro, varav:

  • 1 000 000 euro har betalats till parter i koncerngemenskap
  • 4 000 000 euro har betalats till externa parter.

25 procent av det justerade resultatet är 250 000 euro.

Av nettoränteutgifterna som betalats till externa parter dras 3 000 000 euro av. Icke avdragsgilla är i sin helhet nettoränteutgifterna som betalats till parter i koncerngemenskap och 1 000 000 euro av nettoränteutgifterna som betalats till externa parter.

4.5 Övergångsbestämmelsens inverkan på beräkningen

Enligt övergångsbestämmelsen i NärSkL 18 a § 4 mom. 2 punkten är nettoränteutgifterna avdragsgilla till den del de har betalats till parter som inte är koncerngemenskap och ränteutgifterna baserar sig på lån som har upptagits före den 17 juni 2016 eller har aktiverats i anskaffningsutgiften för tillgången före den 1 januari 2019 med stöd av NärSkL 14 §, 23 § eller 27 c §.

Ränteutgifterna som avses i övergångsbestämmelsen kan med stöd av bestämmelsen dras av endast i situationer där de annars inte kunnat dras av med stöd av NärSkL 18 a § 3 mom. eller 4 mom. 1 punkten. De aktuella ränteutgifterna dras således av med stöd av övergångsbestämmelsen då nettoränteutgifterna som betalats till externa parter är större än 3 000 000 euro. På basis av övergångsbestämmelsen kan man dra av ränteutgifter som avses i bestämmelsen också utöver beloppet beräknat på det justerade resultatet, om 25 procent av det justerade resultatet är större än 3 000 000 euro och nettoränteutgifterna som betalats till externa parter överstiger 25 procent av det justerade resultatet.

Exempel 15: Nettoränteutgifterna under skatteåret är totalt 5 000 000 euro, varav:

  • 1 000 000 euro har betalats till parter i koncerngemenskap
  • 4 000 000 euro har betalats till externa parter, vari ingår 200 000 euro i ränteutgifter enligt NärSkL 18 b § 4 mom. 2 punkten.

25 procent av det justerade resultatet för skatteåret är 3 500 000 euro.

Eftersom nettoränteutgifterna som betalats till externa parter är större än 25 procent av det justerade resultatet och 25 procent av det justerade resultatet är större än 3 000 000 euro tillämpas gränsen på 25 procent. Av nettoränteutgifterna som betalats till externa parter är 3 500 000 euro och dessutom 200 000 euro av ränteutgifterna enligt NärSkL 18 § 4 mom. 2 avdragsgilla. Inga nettoränteutgifter som betalats till parter i koncerngemenskap är avdragsgilla. Avdragsgilla är heller inte 300 000 euro av nettoränteutgifterna som betalats till externa parter.

Exempel 16: Nettoränteutgifterna under skatteåret är totalt 1 300 000 euro, varav:

  • 500 000 euro har betalats till parter i koncerngemenskap
  • 800 000 euro har betalats till externa parter, vari ingår 200 000 euro i ränteutgifter enligt NärSkL 18 a § 4 mom. 2 punkten.

25 procent av det justerade resultatet för skatteåret är 1 000 000 euro.

Ränteutgifterna som betalats till externa parter kan dras av i sin helhet. Dessutom är 200 000 euro (1 000 000 euro - 800 000 euro) av nettoränteutgifterna som betalats till parter i koncerngemenskap avdragsgilla. Icke avdragsgilla är 300 000 euro (500 000 euro - 200 000 euro) av nettoränteutgifterna som betalats till parter i koncerngemenskap. Övergångsbestämmelsen tillämpas inte eftersom nettoränteutgifterna som betalats till externa parter inte överstiger beloppet som får dras av enligt gränsen på 25 procent.

4.6 Fördelning av icke avdragsgilla nettoränteutgifter på olika förvärvskällor

Bestämmelserna om begränsning av rätten till ränteavdrag tillämpas i förvärvskällan för näringsverksamhet, annan verksamhet och jordbruk. Om den skattskyldige har ränteutgifter eller ränteinkomster som hör till flera förvärvskällor, beräknas begränsningen av rätten till ränteavdrag separat för varje skattskyldig på basis av det sammanlagda beloppet av nettoränteutgifterna i förvärvskällorna (NärSkL 18 a § 5 mom.).

De icke avdragsgilla nettoränteutgifterna delas upp i förvärvskällorna i proportion till respektive förvärvskällas relativa andel av nettoränteutgifternas sammanlagda belopp. Den relativa andelen beräknas separat för nettoränteutgifter som betalats till parter i koncerngemenskap och nettoränteutgifter som betalats till externa parter. Därför ska nettoränteutgifterna som betalats till parter i koncerngemenskap och externa parter hållas i sär enligt vilken förvärvskälla de tillhör.

Ränteutgifterna som avses i övergångsbestämmelsen i NärSkL 18 a § 4 mom. 2 punkten dras av i den förvärvskälla där tillhörande skuld finns.

Exempel 17: Nettoränteutgifterna under skatteåret är totalt 950 000 euro, varav:

  • 800 000 euro finns i förvärvskällan för näringsverksamhet
  • 100 000 euro finns i förvärvskällan för annan verksamhet
  • 50 000 euro finns i jordbrukets förvärvskälla.

Nettoränteutgifterna under skatteåret har i sin helhet betalats till parter i koncerngemenskap.

Under skatteåret är 25 procent av det justerade resultatet 700 000 euro. Av nettoränteutgifterna är således 250 000 euro icke avdragsgilla, enligt följande:

  • förvärvskällan för näringsverksamhet 84 procent (800 000/950 000) dvs. 210 000 euro
  • förvärvskällan för annan verksamhet: 11 procent (100 000/950 000) dvs. 27 500 euro
  • jordbrukets förvärvskälla: fem procent (50 000/950 000) dvs. 12 500 euro

Exempel 18: Nettoränteutgifterna under skatteåret är totalt 5 150 000 euro, varav:

  • 5 000 000 euro finns i förvärvskällan för näringsverksamhet
  • 100 000 euro finns i förvärvskällan för annan verksamhet
  • 50 000 euro finns i jordbrukets förvärvskälla.

Av skatteårets nettoränteutgifter har 500 000 euro betalats till parter i koncerngemenskap och 4 650 000 euro till externa parter.

Nettoränteutgifterna som betalats till parter i koncerngemenskap finns i sin helhet i förvärvskällan för näringsverksamhet. Av nettoränteutgifterna som betalats till externa parter finns 4 500 000 euro i förvärvskällan för näringsverksamhet, 100 000 euro i förvärvskällan för annan verksamhet och 50 000 euro i jordbrukets förvärvskälla.

För skatteåret är 25 procent av det justerade resultatet mindre än nettoränteutgifterna som betalats till externa parter och mindre än 3 000 000 euro. Därför tillämpas gränsen på 3 000 000 euro vid beräkningen av de avdragsgilla nettoränteutgifterna.

Nettoränteutgifterna på 500 000 euro som betalats till parter i koncerngemenskap är i sin helhet icke avdragsgilla, liksom också 1 650 000 euro av nettoränteutgifterna som betalats till externa parter. Den icke avdragsgilla delen av nettoränteutgifterna som betalats till externa parter fördelas på de förvärvskällor som har sådana nettoränteutgifter. Som grund för fördelningen används ett relationstal som man erhåller genom att jämföra förvärvskällans nettoränteutgifter som betalats till externa parter med det sammanlagda beloppet av de nettoränteutgifter som betalats till externa parter. De icke avdragsgilla nettoränteutgifterna som betalats till externa parter fördelas på de olika förvärvskällorna enligt följande:

  • förvärvskällan för näringsverksamhet: ca 97 procent (4 500 000 /4 650 000) dvs. 1 596 774,19 euro
  • förvärvskällan för annan verksamhet: ca 2 procent (100 000/4 650 000) dvs. 35 483,87 euro
  • jordbrukets förvärvskälla: ca 1 procent (50 000/4 650 000) dvs. 17 741,94 euro.

De icke avdragsgilla nettoränteutgifterna som betalats till parter i koncerngemenskap finns i sin helhet i förvärvskällan för näringsverksamhet.

Exempel 19: Nettoränteutgifterna under skatteåret är totalt 5 400 000 euro, varav:

  • 5 000 000 euro finns i förvärvskällan för näringsverksamhet, varav 3 000 000 euro har betalats till externa parter
  • 500 000 euro finns i förvärvskällan för annan verksamhet som i sin helhet betalats till externa parter
  • i jordbrukets förvärvskälla finns 100 000 euro i nettoränteinkomster som erhållits från externa parter

25 procent av det justerade resultatet för skatteåret är 50 000 euro. För skatteåret är 25 procent av det justerade resultatet mindre än 3 000 000 euro och mindre än beloppet på nettoränteutgifterna som betalats till externa parter, varför gränsen på 3 000 000 euro tillämpas vid beräkningen av de avdragsgilla ränteutgifterna.

Av nettoränteutgifterna som betalats till externa parter är 3 000 000 euro avdragsgilla. Icke avdragsgilla är i sin helhet nettoränteutgifterna som betalats till parter i koncerngemenskap 2 000 000 euro och 400 000 euro av nettoränteutgifterna som betalats till externa parter.

Den icke avdragsgilla delen av nettoränteutgifterna som betalats till externa parter fördelas på de förvärvskällor som har dylika nettoränteutgifter. I detta fall finns 3 000 000 euro i förvärvskällan för näringsverksamhet och 500 000 euro i förvärvskällan för annan verksamhet. Som grund för fördelningen används ett relationstal som man erhåller genom att jämföra förvärvskällans nettoränteutgifter som betalats till externa parter med det sammanlagda beloppet av de nettoränteutgifter som betalats till externa parter.

  • förvärvskällan för näringsverksamhet 85,7 procent (3 000 000/3 500 000) dvs. 342 857 euro
  • förvärvskällan för annan verksamhet: 14,3 procent (500 000/3 500 000) dvs. 57 143 euro.

De icke avdragsgilla nettoränteutgifterna som betalats till parter i koncerngemenskap delas upp i de förvärvskällor som har dylika nettoränteutgifter. I detta fall finns alla nettoränteutgifter som betalats till parter i koncerngemenskap i förvärvskällan för näringsverksamhet. Dessa nettoränteutgifter på 2 000 000 euro som betalats till parter i koncerngemenskap är i sin helhet icke avdragsgilla.

5 Avdrag av icke avdragsgilla nettoränteutgifter under följande år

5.1 Allmänt

De nettoränteutgifter som inte är avdragsgilla under skatteåret kumuleras för varje förvärvskälla i två poster. I den ena posten kumuleras icke avdragsgilla nettoränteutgifter som betalats till parter i koncerngemenskap och i den andra icke avdragsgilla nettoränteutgifter som betalats till externa parter.

Under skatteåret avdras i första hand ränteutgifterna för skatteåret ifråga. Beloppet på de avdragsgilla ränteutgifterna för skatteåret beräknas utifrån respektive års nettoränteutgifter och de gränser som tillämpas på dem under det aktuella skatteåret i enlighet med det som beskrivs i kapitel 4 (se också CSN 2021:20 ej lagakraftvunnet).  Enligt NärSkL 18 a § 8 mom. kan icke avdragsgilla nettoränteutgifter från tidigare skatteår dras av från inkomsterna under de följande skatteåren inom ramen för respektive skatteårs gränser efter att nettoränteutgifterna för skatteåret ifråga dragits av.

Beloppet på de icke avdragsgilla nettoränteutgifterna från tidigare år som eventuellt dras av under skatteåret beror på om bolaget har nettoränteutgifter under skatteåret, om nettoränteutgifternas belopp under skatteåret överstiger 500 000 euro och om ränteutgifterna under skatteåret dras av enligt gränsen på 25 procent eller gränsen på 3 000 000 euro då nettoränteutgifterna överstiger 500 000 euro.

Om de icke avdragsgilla ränteutgifterna från tidigare år kan dras av under skatteåret, avdras i första hand de icke avdragsgilla nettoränteutgifterna från tidigare år som betalats till externa parter. Det finns ingen tidsgräns för avdraget. Om de icke avdragsgilla nettoränteutgifterna från tidigare år finns i olika förvärvskällor, avdras tidigare års nettoränteutgifter i relation till den relativa andelen i respektive förvärvskälla. Om den skattskyldige har icke avdragsgilla nettoränteutgifter från tidigare år som uppstått under skatteåren 2014–2018, kan dessa dras av under följande år på samma sätt som icke avdragsgilla nettoränteutgifter från tidigare år som betalats till parter i koncerngemenskap.

De icke avdragsgilla nettoränteutgifterna får i regel dras av separat i varje förvärvskälla från inkomsterna i respektive förvärvskälla under de följande åren upp till beloppet av de avdragsgilla nettoränteutgifterna under respektive skatteår. Därför kan till exempel icke avdragsgilla nettoränteutgifter i den personliga förvärvskällan dras av under de följande åren i den personliga förvärvskällan upp till beloppet av de avdragsgilla nettoränteutgifterna i förvärvskällan under skatteåret.

Från och med skatteåret 2020 kan vissa samfund enligt NärSkL 1 § 2 mom. inte ha en personlig förvärvskälla utan verksamheten som samfunden bedriver, med undantag av jordbruk, beskattas i förvärvskällan för näringsverksamhet. Ett dylikt samfund som omfattas av slopandet av indelningen i förvärvskällor kan ha icke avdragsgilla nettoränteutgifter som uppstått i den personliga förvärvskällan skatteåret 2019. De icke avdragsgilla nettoränteutgifterna dras enligt huvudregeln i NärSkL 18 a § 9 mom. av separat i varje förvärvskälla. Enligt NärSkL 18 a § 10 mom. får icke avdragsgilla nettoränteutgifter som uppkommit i den personliga förvärvskällan skatteåret 2019 dock vid beskattningen av samfund som omfattas av slopandet av indelningen i förvärvskällor dras av i förvärvskällan för näringsverksamhet på samma sätt som icke avdragsgilla nettoränteutgifter som uppkommit i förvärvskällan för näringsverksamhet. NärSkL 18 a § 10 mom. tillämpas retroaktivt redan från skatteåret 2020. Samfund som med stöd av NärSkL 18 a § 10 mom. skulle ha haft möjlighet att i förvärvskällan för näringsverksamhet under skatteåret 2020 dra av icke avdragsgilla ränteutgifter som uppstått i den personliga förvärvskällan, kan därför göra en begäran om omprövning avseende beskattningen för skatteåret 2020 och yrka att NärSkL 18 a § 10 mom. ska tillämpas i beskattningen 2020.

Icke avdragsgilla nettoränteutgifter från tidigare år kan dras av under följande skatteår som beskrivs i följande flödesplan:

Flödesplan som beskriver hur tidigare skatteårs icke avdragsgilla nettoränteutgifter dras av under följande år.

Företaget ska yrka på avdrag av icke avdragsgilla nettoränteutgifter från tidigare skatteår och i sitt yrkande ge en utredning över grunderna för avdraget. Man yrkar på avdraget med en bilageblankett till skattedeklarationen för det skatteår för vilket avdrag yrkas. Ett yrkande på avdrag ska göras innan beskattningen slutförs.

Om bolaget har nettoränteinkomster under skatteåret, kan de icke avdragsgilla nettoränteutgifterna från tidigare skatteår dras av till ett belopp som motsvarar skatteårets nettoränteinkomster. Utöver detta får de icke avdragsgilla nettoränteutgifterna från tidigare skatteår dras av antingen enligt gränsen på 500 000 euro eller 3 000 000 euro, beroende på om de icke avdragsgilla ränteutgifterna från tidigare skatteår har betalats till parter i koncerngemenskap eller externa parter (se exempel 21).

5.2 Nettoränteutgifterna under skatteåret högst 500 000 euro

Om nettoränteutgifterna under skatteåret är högst 500 000 euro kan icke avdragsgilla nettoränteutgifter från tidigare år dras av antingen inom ramen för gränsen på 500 000 euro eller inom ramen för gränsen på 3 000 000 euro beroende på beloppen av den skattskyldiges nettoränteutgifter under skatteåret och de icke avdragsgilla nettoränteutgifterna från tidigare skatteår som betalats till externa parter.

Om de icke avdragsgilla nettoränteutgifterna från tidigare år som betalats till externa parter är mindre än skillnaden mellan 500 000 euro och nettoränteutgifterna under skatteåret, kan alla icke avdragsgilla nettoränteutgifter från tidigare år som betalats till externa parter dras av. Dessutom kan icke avdragsgilla nettoränteutgifter från tidigare skatteår som betalats till parter i koncerngemenskap dras av så att nettoränteutgifterna under skatteåret och tidigare års nettoränteutgifter som betalats till parter i koncerngemenskap och externa parter uppgår till totalt högst 500 000 euro.

Om de icke avdragsgilla nettoränteutgifterna från tidigare år som betalats till externa parter är större än skillnaden mellan 500 000 euro och skatteårets nettoränteutgifter, kan de icke avdragsgilla nettoränteutgifterna från tidigare år som betalats till externa parter dras av så att totalbeloppet av de avdragsgilla nettoränteutgifterna under skatteåret och de icke avdragsgilla nettoränteutgifterna från tidigare år som betalats till externa parter är högst 3 000 000 euro. Icke avdragsgilla ränteutgifter från tidigare år som betalats till parter i koncerngemenskap kan härvid inte dras av.

Exempel 20: Nettoränteutgifterna under skatteåret är totalt 300 000 euro, varav:

  • 200 000 euro har betalats till parter i koncerngemenskap
  • 100 000 euro har betalats till externa parter.

Ränteutgifterna under skatteåret dras av enligt gränsen på 500 000 euro, som överstiger skatteårets nettoränteutgifter med 200 000 euro. Alla ränteutgifter under skatteåret är avdragsgilla.

a) Från tidigare år finns icke avdragsgilla nettoränteutgifter enligt följande:

  • 150 000 euro som har betalats till externa parter
  • 200 000 euro som har betalats till parter i koncerngemenskap.

Då gränsen på 500 000 euro tillämpas kan utöver årets ränteutgifter även icke avdragsgilla nettoränteutgifter från tidigare år dras av enligt följande:

  • 150 000 euro som har betalats till externa parter
  • 50 000 euro som har betalats till parter i koncerngemenskap

b) Från tidigare år finns icke avdragsgilla nettoränteutgifter enligt följande:

  • 500 000 euro som har betalats till externa parter
  • 200 000 euro som har betalats till parter i koncerngemenskap.

Då gränsen på 3 000 000 euro tillämpas kan utöver årets ränteutgifter även icke avdragsgilla nettoränteutgifter från tidigare år dras av enligt följande:

  • 500 000 euro som har betalats till externa parter
  • nettoränteutgifterna som betalats till parter i koncerngemenskap kan inte dras av.

c) Från tidigare år finns icke avdragsgilla nettoränteutgifter enligt följande:

  • 2 900 000 euro som har betalats till externa parter
  • 200 000 euro som har betalats till parter i koncerngemenskap.

Då gränsen på 3 000 000 euro tillämpas kan utöver årets ränteutgifter även icke avdragsgilla nettoränteutgifter från tidigare år dras av enligt följande:

  • 2 700 000 euro som har betalats till externa parter
  • nettoränteutgifterna som betalats till parter i koncerngemenskap kan inte dras av.

Exempel 21: Nettoränteinkomsterna under skatteåret är totalt 200 000 euro.

De icke avdragsgilla nettoränteutgifterna från tidigare skatteår kan till att börja med dras av till ett belopp som motsvarar nettoränteinkomsterna under skatteåret, så att nettoränteutgifterna som betalats till externa parter dras av först. Efter det kan dessutom de icke avdragsgilla ränteutgifterna från tidigare skatteår beroende på omständigheterna dras av enligt gränsen på 500 000 euro eller 3 000 000 euro.

a) Från tidigare år finns icke avdragsgilla nettoränteutgifter enligt följande:

  • 1 500 000 euro som har betalats till externa parter
  • 200 000 euro som har betalats till parter i koncerngemenskap

De icke avdragsgilla nettoränteutgifterna från tidigare skatteår kan till att börja med dras av till ett belopp som motsvarar nettoränteinkomsterna (200 000 euro), så att nettoränteutgifterna som betalats till externa parter dras av först. Efter det kan de icke avdragsgilla ränteutgifterna från tidigare skatteår som betalats till externa parter dessutom dras av enligt gränsen på 3 000 000 euro enligt följande:

  • 1 300 000 euro som har betalats till externa parter
  • nettoränteutgifterna som betalats till parter i koncerngemenskap kan inte dras av.

b) Från tidigare år finns icke avdragsgilla nettoränteutgifter enligt följande:

  • 100 000 euro som har betalats till externa parter
  • 700 000 euro som har betalats till parter i koncerngemenskap

De icke avdragsgilla nettoränteutgifterna från tidigare skatteår som betalats till externa parter och parter i koncerngemenskap kan till att börja med dras av till ett totalbelopp som motsvarar nettoränteinkomsterna (100 000 + 100 000 euro), så att nettoränteutgifterna som betalats till externa parter dras av först. Efter det kan de icke avdragsgilla nettoränteutgifterna från tidigare år som betalats till parter i koncerngemenskap dessutom dras av enligt gränsen på 500 000 euro enligt följande:

  • 500 000 euro som har betalats till parter i koncerngemenskap.
  • Av nettoränteutgifterna som betalats till parter i koncerngemenskap dras 100 000 euro inte av.

5.3 Nettoränteutgifterna under skatteåret överstiger 500 000 euro

Då skatteårets nettoränteutgifter överstiger 500 000 euro tillämpas antingen gränsen på 3 000 000 euro eller gränsen på 25 procent på beräkningen av de avdragsgilla ränteutgifterna under skatteåret. Således utgör gränsen som tillämpas på ränteavdraget under skatteåret också gränsen för hur mycket icke avdragsgilla nettoränteutgifter från tidigare år som kan dras av.

Om skatteårets ränteutgifter dragits av enligt gränsen på 3 000 000 euro, utgör denna gräns också avdragets maximibelopp då nettoränteutgifterna under skatteåret och nettoränteutgifterna från tidigare år som betalats till utomstående parter räknas samman. Om skatteårets ränteutgifter däremot dragits av enligt gränsen på 25 procent kan de icke avdragsgilla nettoränteutgifterna från tidigare år inte dras av enligt gränsen på 3 000 000 euro.

Om skatteårets nettoränteutgifter dragits av enligt gränsen på 25 procent och nettoränteutgifterna under skatteåret är mindre än 25 procent av det justerade resultatet, kan de icke avdragsgilla nettoränteutgifterna från tidigare år dras av så att totalbeloppet av de avdragsgilla nettoränteutgifterna under skatteåret och de icke avdragsgilla nettoränteutgifterna från tidigare år som dras av under skatteåret är högst 25 procent av det justerade resultatet för skatteåret.

Från tidigare års icke avdragsgilla ränteutgifter avdras i första hand de icke avdragsgilla nettoränteutgifterna som betalats till externa parter.

Exempel 22: Nettoränteutgifterna under skatteåret är totalt 1 300 000 euro, varav:

  • 600 000 euro har betalats till parter i koncerngemenskap
  • 700 000 euro har betalats till externa parter.

25 procent av det justerade resultatet är 1 500 000 euro.

Nettoränteutgifterna under skatteåret dras av enligt gränsen på 25 procent. Rätten att dra av ränteutgifter begränsas således inte för skatteåret ifråga.

Från tidigare år finns icke avdragsgilla nettoränteutgifter enligt följande:

  • 150 000 euro som har betalats till externa parter
  • 200 000 euro som har betalats till parter i koncerngemenskap.

Utöver skatteårets ränteutgifter även icke avdragsgilla nettoränteutgifter från tidigare år dras av enligt följande:

  • 150 000 euro som har betalats till externa parter
  • 50 000 euro som har betalats till parter i koncerngemenskap.

De gamla icke avdragsgilla nettoränteutgifterna kan inte dras av enligt gränsen på 3 000 000 euro, eftersom nettoränteutgifterna under skatteåret dras av enligt gränsen på 25 procent.

Om skatteårets nettoränteutgifter har dragits av enligt gränsen på 3 000 000 euro, kan nettoränteutgifter från tidigare år som betalats till externa parter dras av så att totalbeloppet av de avdragsgilla nettoränteutgifterna under skatteåret som betalats till externa parter och de icke avdragsgilla nettoränteutgifterna från tidigare år som betalats till externa parter som dras av under skatteåret är högst 3 000 000 euro. Tidigare års icke avdragsgilla ränteutgifter som betalats till parter i koncerngemenskap kan i dylika fall inte dras av.

Exempel 23: Nettoränteutgifterna under skatteåret är totalt 1 500 000 euro, varav:

  • 500 000 euro har betalats till parter i koncerngemenskap
  • 1 000 000 euro har betalats till externa parter.

25 procent av det justerade resultatet är 0,00 euro, varför nettoränteutgifterna under skatteåret dras av enligt gränsen på 3 000 000 euro.

Av nettoränteutgifterna som betalats till externa parter under skatteåret dras 1 000 000 euro av. Nettoränteutgifterna som betalats till parter i koncerngemenskap är i sin helhet icke avdragsgilla.

a) Från tidigare år finns icke avdragsgilla nettoränteutgifter enligt följande:

  • 200 000 euro som har betalats till parter i koncerngemenskap
  • 2 500 000 euro som har betalats till externa parter.

Förutom årets ränteutgifter kan även 2 000 000 euro av nettoränteutgifterna från tidigare år som betalats till externa parter dras av. Tidigare års nettoränteutgifter som betalats till parter i koncerngemenskap kan inte dras av.

b) Från tidigare år finns icke avdragsgilla nettoränteutgifter enligt följande:

  • 200 000 euro som har betalats till parter i koncerngemenskap
  • 1 500 000 euro som har betalats till externa parter.

Förutom årets ränteutgifter kan alla icke avdragsgilla nettoränteutgifter från tidigare år som betalats till externa parter dras av. Tidigare års icke avdragsgilla nettoränteutgifter som betalats till parter i koncerngemenskap kan inte dras av.

Om gränsen på 25 procent tillämpats på avdraget av nettoränteutgifterna under skatteåret och nettoränteutgifterna under skatteåret är större än 25 procent av det justerade resultatet, kan de icke avdragsgilla nettoränteutgifterna från tidigare år inte dras av. De icke avdragsgilla nettoränteutgifterna från tidigare år kan heller inte dras av då gränsen på 3 000 000 euro tillämpats på avdraget av nettoränteutgifterna under skatteåret och nettoränteutgifterna som betalats till externa parter under skatteåret uppgår till 3 000 000 euro eller mer.

Exempel 24: Nettoränteutgifterna under skatteåret är totalt 1 100 000 euro, varav:

  • 1 000 000 euro har betalats till parter i koncerngemenskap
  • 100 000 euro har betalats till externa parter.

25 procent av det justerade resultatet är 250 000 euro. I nettoränteutgifter under skatteåret dras 250 000 euro av enligt gränsen på 25 procent.

De icke avdragsgilla nettoränteutgifterna för tidigare år kan inte dras av enligt gränsen på 25 procent, eftersom nettoränteutgifternas belopp under skatteåret överstiger beloppet som får dras av enligt gränsen på 25 procent. De icke avdragsgilla nettoränteutgifterna för tidigare år kan heller inte dras av enligt gränsen på 3 000 000 euro, då nettoränteutgifterna för skatteåret dras av enligt gränsen på 25 procent.

Exempel 25: Nettoränteutgifterna under skatteåret är totalt 5 000 000 euro, varav:

  • 1 000 000 euro har betalats till parter i koncerngemenskap
  • 4 000 000 euro har betalats till externa parter.

Nettoränteutgifterna som dras av enligt gränsen på 25 procent uppgår till 250 000 euro. Av nettoränteutgifterna som betalats till externa parter under skatteåret dras 3 000 000 euro av enligt gränsen på 3 000 000 euro.

De icke avdragsgilla ränteutgifterna från tidigare skatteår kan inte dras av enligt gränsen på 25 procent eftersom gränsen på 3 000 000 euro tillämpas på avdraget av nettoränteutgifterna under skatteåret. Tidigare års icke avdragsgilla nettoränteutgifter kan heller inte dras av enligt gränsen på 3 000 000 euro, eftersom nettoränteutgifterna som betalats till externa parter under skatteåret överstiger beloppet som får dras av.

5.4 Hur ägarbyte och företagsomstrukturering inverkar på rätten att dra av nettoränteutgifter

Ägarbyten påverkar inte rätten att dra av tidigare års icke avdragsgilla nettoränteutgifter under påföljande år. Ett bolag kan följaktligen efter ett ägarbyte använda icke avdragsgilla nettoränteutgifter från tidigare år under de följande skatteåren i enlighet med bestämmelsen om räntebegränsning för respektive år. Vid fission av samfund överförs de icke avdragsgilla nettoränteutgifterna från tidigare år till det övertagande samfundet till den del det är uppenbart, att den icke avdragsgilla nettoränteutgiften har uppstått i verksamhet som överförts till det övertagande samfundet. Till övriga delar överförs icke avdragsgilla nettoränteutgifter i samma proportion som det överlåtande samfundets nettoförmögenhet enligt 2 kap. i lagen om värdering av tillgångar vid beskattningen (1142/2005) överförs till det övertagande samfundet.

Vid fusion av ett samfund överförs det överlåtande samfundets icke avdragsgilla nettoränteutgifter från tidigare år till det övertagande samfundet.  

Vid överföring av affärsverksamhet överförs däremot inte det överlåtande samfundets icke avdragsgilla nettoränteutgifter till det övertagande samfundet.

6 Undantaget som grundar sig på en jämförelse av balansräkningar

6.1 Tillämpning av undantaget som grundar sig på en jämförelse av balansräkningar

Syftet med bestämmelsen om räntebegränsning i NärSkL 18 a § är att begränsa rätten att dra av ränteutgifter. Enligt undantaget i NärSkL 18 b § 1 mom. 4 punkten tillämpas ränteavdragsbegränsning inte om bolaget på det sätt som avses i NärSkL 18 b § 5 mom. lägger fram en utredning om att relationen mellan dess egna kapital och balansomslutningen enligt det revisorsgranskade och fastställda bokslutet är större eller lika stort som motsvarande tal i fråga om den revisorsgranskade och fastställda balansomslutningen i koncernbokslutet vid skatteårets slut (nedan undantaget som grundar sig på en jämförelse av balansräkningar).

Enligt regeringens tidigare proposition (RP 146/2012 rd) som gäller bestämmelsen om räntebegränsning är syftet med regleringen av undantaget som grundar sig på en jämförelse av balansräkningar att möjliggöra avdrag av ränteutgifterna på grundval av den skattskyldiges utredning i det fall att det egna kapitalets andel av balansomslutningen i ett enskilt företag är på minst samma nivå som i hela koncernen. Avsikten med detta har enligt regeringens proposition varit att lindra inverkan av den nya begränsningen på den centraliserade koncernfinansieringen.

Tillämpningen av undantaget som grundar sig på en jämförelse av balansräkningar ska enligt NärSkL 18 b § 1 mom. 4 punkten i regel basera sig på revisorsgranskade och fastställda balansräkningar. Jämförelsen är möjlig att göra endast om balansräkningarna upprättats vid utgången av den skattskyldiges skatteår. Posterna i tillgångsberäkningen i skattedeklarationen som används vid beräkningen av nettotillgångarna påverkar inte beräkningen av relationstalet. Posterna i balansräkningarna som jämförs korrigeras i regel inte till någon del (se HFD 2015:11). Enligt NärSkL 18 b § 5 mom. ska balansräkningarna som jämförs upprättas enligt samma bestämmelser, varför en av balansräkningarna kan behöva omvandlas helt för jämförelsen. Enligt samma moment ska det egna kapitalet i koncernbalansräkningen även då förutsättningarna uppfylls korrigeras vid tillämpning av undantaget som grundar sig på en jämförelse av balansräkningar (se kapitel 6.5). 

Enligt finansutskottets betänkande (FiUB 32/2021 rd) avses med revision enligt NärSkL 18 b § 1 mom. 4 punkten lagstadgad revision av det officiella bokslutet. Revision och fastställande av bokslut ska göras, även om balansräkningen senare kommer att omvandlas för jämförelse av balansräkningar med stöd av 18 b § 5 mom.

Vid tillämpning av undantaget som baserar sig på jämförelse av balansräkningar till exempel i beskattningen av ett överlåtande dotterbolag kan man i stället för ett fastställt bokslut använda det överlåtande bolagets fastställda slutredovisning som avses i 16 kap. 17 § i aktiebolagslagen. En förutsättning för tillämpningen av undantaget är härvid att slutredovisningen och koncernbokslutet upprättats för den dag då den skattskyldiges skatteår löper ut.

Undantaget som grundar sig på en jämförelse av balansräkningar kan tillämpas endast när bolaget lägger fram en koncernbalansräkning som avses i bestämmelsen (se kapitel 6.4). Undantaget kan då de övriga villkoren uppfylls tillämpas även i situationer där den skattskyldige som upprättar bolagets balansräkning, som jämförs med koncernbalansräkningen, är koncernens moderbolag, som upprättar koncernbalansräkningen som används vid jämförelsen.

6.2 Om förutsättningarna för koncernbalansräkningen

Då undantaget som grundar sig på en jämförelse av balansräkningar tillämpas avses med koncernbalansräkning en balansräkning som inkluderats i ett revisorsgranskat och fastställt koncernbokslut enligt de internationella redovisningsstandarder som avses i 7 a kap. 1 § i bokföringslagen. Jämförelsen grundar sig i första hand på koncernens revisorsgranskade och fastställda IFRS-bokslut. Om ett bokslut enligt de internationella redovisningsstandarderna inte upprättats, används en balansräkning som inkluderats i ett revisorsgranskat och fastställt koncernbokslut som upprättats enligt bokföringslagstiftningen i en EU-medlemsstat eller i en stat inom EES och, om ett sådant saknas, ett bokslut som upprättats enligt motsvarande bestämmelser. Då kan det vara fråga om ett koncernbokslut som revisorsgranskats och fastställts i enlighet med US GAAP.

Koncernbalansräkningen som används vid jämförelsen ska ha upprättats i en EU-medlemsstat, EES-stat eller i en stat med vilken Finland har ett gällande inkomstskatteavtal i syfte att undvika dubbel beskattning. Koncernbalansräkningen kan följaktligen ha upprättats, revisorsgranskats och fastställts utomlands.

Högsta förvaltningsdomstolen ansåg i sitt årsboksavgörande HFD 2021:124 att en jämförelse av balansräkningar kan göras endast om den bokföringsskyldiges balansräkning som används i jämförelsen är del av ett fullständigt revisorsgranskat och fastställt koncernbokslut som uppfyller förutsättningarna i bokföringslagstiftningen, och som innehåller bland annat finansieringsanalys och noter.

I avgörandet HFD 2021:124 var det fråga om en situation där B Kb inte hade för avsikt att göra ett koncernbokslut som uppfyller bokföringslagens bestämmelser. Högsta förvaltningsdomstolen ansåg därför att det av B Kb gjorda koncernbokslutet inte kunde anses utgöra en i NärSkL 18 a § 3 mom. avsedd utredning över att det egna kapitalets förhållande till balansräkningens slutsumma i det fastställda bokslutet är högre eller lika stort som det fastställda koncernbokslutets motsvarande relationstal vid skatteårets slut i bolaget som yrkat på tillämpning av undantaget som grundar sig på en jämförelse av balansräkningar.

Vid jämförelse av balansräkningar avses enligt regeringens proposition (RP 146/2012 rd) med en koncernbalansräkning hela koncernens koncernbalansräkning, inte en underkoncerns balansräkning. Bedömningen vilken part det är som ska upprätta koncernbalansräkningen som används för jämförelsen av balansräkningar, görs utifrån det bestämmande inflytandet enligt bokföringslagstiftningen. Ifall en annan bokföringsskyldig har bestämmande inflytande över en bokföringsskyldig som upprättar koncernbalansräkning, anses koncernbalansräkningen som sistnämnda bokföringsskyldiga upprättar utgöra balansräkning för underkoncernen, som jämförelse inte kan göras med. I rättspraxis har bland annat ansetts att bestämmande inflytande uppstår då den bokföringsskyldige innehar minst hälften av aktiekapitalet i den bokföringsskyldige som upprättat koncernbalansräkningen. I rättspraxis har också ansetts att underkoncernens koncernbokslut inte kan betraktas som ett koncernbokslut som föreskrivs i NärSkL 18 a § 3 mom., även om bolaget som ägde majoriteten av aktierna i underkoncernens moderbolag inte var skyldigt enligt den nationella lagstiftningen i sin hemviststat att utarbeta ett bokslut som skulle ha inkluderat koncernbolaget som begärde tillämpning av undantaget (se HFD 24.6.2015 liggare 1784, HFD 2018:2, HFD 2020:47, HFD 2021:123 och HFD 2021:124).

Tillämpningen av undantaget som grundar sig på en jämförelse av balansräkningar i en så kallad kommunkoncern togs upp i centralskattenämndens förhandsavgörande CSN 10/2014. CSN ansåg i sitt avgörande om en specialsituation som berör en kommunkoncern att den koncernbalansräkning som det kommunägda moderbolaget hade upprättat var en sådan koncernbalansräkning som avses i undantagsbestämmelsen.

6.3 Omvandlad balansräkning

Om koncernbalansräkningen helt eller delvis upprättats enligt andra bestämmelser än den skattskyldiges balansräkning, kan jämförelsen som grundar sig på en jämförelse av balansräkningar enligt 18 b § 5 mom. i NärSkL tillämpas endast om den skattskyldige lägger fram den fastställda koncernbalansräkningen i den form den skulle ha haft, om den hade upprättats enligt samma bestämmelser som den skattskyldiges balansräkning eller om den skattskyldige lägger fram sin egen balansräkning i den form den skulle ha haft, om den hade upprättats enligt samma bestämmelser som koncernbalansräkningen. Relationstalen i balansräkningen i företagets bokslut och i koncernbalansräkningen ska därför bygga på samma slags metod för värdering av tillgångar och skulder.

Om den skattskyldiges balansräkning till exempel upprättats enligt bokföringslagen och koncernbalansräkning enligt de internationella redovisningsstandarderna kan siffrorna i koncernbalansräkningen redovisas i enlighet med bokföringslagen. Alternativt kan företaget redovisa sin balansräkning anpassad i den form den skulle ha haft, om den hade upprättats enligt samma bestämmelser som koncernbalansräkningen. Jämförelsen kan inte i sig göras till exempel mellan ett bolags balansräkning som upprättats enligt nationell bokföringslagstiftning och en balansräkning i ett koncernbokslut som upprättats enligt internationella redovisningsstandarder. 

Enligt Finansutskottets betänkande (FiUB 21/2018 rd) ska balansräkningen i företagets fastställda bokslut eller den fastställda koncernbalansräkningen redovisas i en helt omvandlad form då balansräkningarna upprättats med olika metoder. Balansräkningen ska upprättas på samma sätt och med samma noggrannhet som om den ursprungligen hade upprättats enligt bestämmelserna i den andra balansräkningen som används i jämförelsen. Det är möjligt att utföra jämförelsen som avses i bestämmelsen endast då alla poster i den omvandlade balansräkningen värderats enligt samma metod som i den andra balansräkningen i jämförelsen.

I situationen som förelåg i centralskattenämndens förhandsavgörande (CSN 19/2019) hade B Ab:s och dess helägda Fastighet Ab A:s balansräkning upprättats enligt bestämmelserna i bokföringslagen. I balansräkningen i koncernbokslutet som B Ab upprättat hade investeringsfastigheterna värderats till verkligt värde enligt 5 kap. 2 b § i bokföringslagen. I Fastighet Ab A:s balansräkning hade fastigheterna värderats till anskaffningsutgift enligt 5 kap 5 § i bokföringslagen. Centralskattenämnden ansåg att koncernbokslutet under de i ansökan beskrivna omständigheterna hade upprättats på så sätt som avses i NärSkL 18 b § 5 mom. delvis enligt andra bestämmelser än Fastighet Ab A:s balansräkning. Om Fastighet Ab A värderade fastigheterna i sin balansräkning som upprättas för jämförelse av balansräkningar till verkligt värde enligt 5 kap. 2 b § i bokföringslagen, ansågs balansräkningen vara upprättad enligt NärSkL 18 b § 5 mom. enligt samma bestämmelser som koncernbalansräkningen.

Enligt regeringens proposition (RP 211/2021 rd) omfattar kravet på revision i NärSkL 18 b § 1 mom. 4 punkten inte balansräkningar som omvandlats enligt 5 mom. Den skattskyldige kan enligt finansutskottets betänkande (FiUB 21/2018 rd) efter eget val lämna sin egen försäkran över den omvandlade balansräkningen.

6.4 Korrigering av eget kapital i koncernbalansräkningen

När jämförelsen av balansräkningar görs betraktas enligt NärSkL 18 b § 5 mom. en skuld i koncernbalansräkningen som eget kapital till den del den har upptagits hos en aktör när aktören eller en aktör som är i intressegemenskap med den förstnämnda aktören på det sätt som avses i 2 mom. 3–5 punkten eller dessa tillsammans direkt eller indirekt har minst tio procent av kapitalet eller rösträtten i den skattskyldige eller en aktör som är i intressegemenskap med denne på det sätt som avses i den nämnda bestämmelsen eller har rätt att få minst tio procent av den vinst de avkastar.

I koncernbalansräkningen som används vid jämförelsen ska främmande kapital därför korrigeras till eget kapital då förutsättningarna uppfylls. Då förutsättningarna uppfylls ska korrigering göras även i den omvandlade koncernbalansräkningen.

Då ägarandelen beräknas enligt bestämmelsen om korrigering beaktas det innehav som både borgenären och en aktör som är i intressegemenskap med borgenären har i den skattskyldige eller i en aktör som är i intressegemenskap med denne.  En andel på tio procent av kapitalet, rösträtten eller vinsten kan också uppfyllas så att borgenären och en aktör i intressegemenskap med denne tillsammans äger minst tio procent av den skattskyldige eller av en aktör i intressegemenskap med denne.

Då bestämmelsen om korrigering tillämpas avses med definitionen av intressegemenskap definitionen i NärSkL 18 b § 2 mom. 3–5 punkten, enligt vilken som fristående samfund inte betraktas ett samfund, öppet bolag eller kommanditbolag:

  • som direkt eller indirekt har en andel i form av rösträtt eller kapitalinnehav motsvarande 25 procent eller mer i ett annat subjekt eller har rätt att motta 25 procent eller mer av vinsterna i det subjektet;
  • i vars rösträtt, kapital eller vinster en fysisk person eller ett annat subjekt direkt eller indirekt har en andel på 25 procent eller mer; eller
  • som har samband med ett eller flera andra subjekt på den grund att en fysisk person eller ett subjekt direkt eller indirekt har en andel på 25 procent eller mer av det och det andra företaget.

Definitionen av intressegemenskap som används vid korrigering av eget kapital skiljer sig därför från definitionen i BFL 31 §.

Då ägarandelen enligt bestämmelsen om korrigering beräknas beaktas både direkt och indirekt innehav. Indirekt innehav beräknas proportionellt så att innehaven i varje steg multipliceras.

Om indirekt innehav uppkommer via en aktör som är i intressegemenskap med borgenären, beaktas ett dylikt innehav endast en gång vid beräkning av ägarandelen. Antingen borgenärens innehav eller innehavet som uppkommer via en aktör som är i intressegemenskap med denne beaktas, beroende på vilket som är störst. Beaktande av indirekt innehav förutsätter inget minimiinnehav hos den aktör via vilken det indirekta innehavet uppkommer.

Tillämpning av bestämmelsen om korrigering beskrivs i följande fyra exempel. De två första exemplen (26 och 27) gäller beaktande av parter i intressegemenskap och beräkning av indirekt innehav. De två senare exemplen (28 och 29) beskriver mer omfattande situationer som hör till bestämmelsens tillämpningsområde.

Exempel 26:

Bolag A äger 15 procent av aktierna i moderbolag B. Moderbolag B äger 60 procent av aktierna i det skattskyldiga bolaget C. A har gett lån till moderbolaget B. Mellan A och B finns inget bestämmande inflytande enligt bokföringslagen. Moderbolag B har upprättat koncernbalansräkningen, som lagts fram för jämförelse av balansräkningar mellan det skattskyldiga bolaget C och moderbolaget B.

A och moderbolaget B är inte i intressegemenskap med varandra det sätt som avses i NärSkL 18 b § 2 mom. 3–5 mom. eftersom A äger endast 15 % av aktierna i moderbolaget B. I en dylik situation beaktas vid beräkning av ägarandelen enligt bestämmelsen A:s indirekta innehav i det skattskyldiga bolaget C proportionellt så att innehaven i varje steg multipliceras (15 procent x 60 procent = 9 procent). Eftersom ägarandelen är under 10 %, görs ingen korrigering av lånen som A beviljat i koncernbalansräkningen som B upprättat.

Exempel 26 i bildform.

Exempel 27:

Bolag A äger 7 procent av aktierna i moderbolag B. På grund av sitt aktieinnehav har bolag A 30 % av rösträtten i moderbolag B. Moderbolag B äger 50 procent av aktierna i det skattskyldiga bolaget C. A har beviljat lån till moderbolaget B. 

Mellan A och B finns inget bestämmande inflytande enligt bokföringslagen. Moderbolag B har upprättat koncernbalansräkningen, som lagts fram som grund för jämförelsen av balansräkningar mellan det skattskyldiga bolaget C och moderbolaget B.

A och moderbolaget B är på grund av rösträtten på 30 procent i intressegemenskap med varandra på det sätt som avses i NärSkL 18 b § 2 mom. 3 punkten. Moderbolag B som är i intressegemenskap med A äger 50 procent av aktierna i skattskyldige C. Bolag A:s indirekta innehav i skattskyldige C beaktas inte då ägarandelen enligt bestämmelsen beräknas, eftersom innehavet uppkommer via moderbolaget B som är i intressegemenskap med A. Moderbolaget B:s direkta innehav i skattskyldige C beaktas till det fulla beloppet då ägarandelen beräknas.

Moderbolag B som är i intressegemenskap med A äger 50 % av aktierna i skattskyldige C, varför ägarandelen är över 10 % och korrigering av lånen som A beviljat ska göras i koncernbalansräkningen som moderbolaget B upprättat. 

Förutsättningarna för att tillämpa bestämmelsen om korrigering av koncernbalansräkningen uppfylls i exempelsituationen också därför att A har minst 10 % av rösträtten i moderbolaget B, som är i intressegemenskap med skattskyldige C.

Exempel 27 i bildform.

Exempel 28:

En kapitalfond äger 20 procent av koncernens moderbolag, som äger 100 procent av ett holdingbolag, som i sin tur äger 100 procent av ett finländskt skattskyldigt bolag. Beloppet av koncernens eget kapital enligt koncernbokslutet är tio miljoner euro och det skatteskyldiga bolagets eget kapital är sju miljoner euro. Kapitalfonden har gett moderbolaget ett lån på tio miljoner euro och det skattskyldiga bolaget ett lån på åtta miljoner euro. Moderbolaget har åter gett det skattskyldiga bolaget ett lån på 9,5 miljoner euro. Skulden till moderbolaget i det skattskyldiga bolagets balansräkning och moderbolagets motsvarande fordran elimineras när koncernbalansräkningen görs upp. Ingen kapitalfond eller annan aktör har bestämmande inflytande i moderbolaget. I moderbolagets koncernbalansräkning som ingår i det revisorsgranskade och fastställda koncernbokslutet ingår moderbolagets och det skattskyldiga bolagets skuld till kapitalfonden (sammanlagt 18 miljoner euro) och tio miljoner euro i andra skulder.

Skulden till kapitalfonden (sammanlagt 18 miljoner euro) betraktas som eget kapital i koncernbalansräkningen när jämförelsen av balansräkningar görs, eftersom kapitalfonden indirekt äger minst 10 % av den skattskyldige. I det skattskyldiga bolagets balansräkning finns skuld både till moderbolaget (9,5 miljoner euro) och till kapitalfonden (åtta miljoner euro). Soliditetsgraden (eget kapital i relation till balansomslutningen) hos det skattskyldiga bolaget som yrkar på jämförelse av balansräkningar är svagare än hela koncernens soliditetsgrad och undantaget som grundar sig på en jämförelse av balansräkningar tillämpas inte.

Exempel 28 i bildform.

Exempel 29:

Flera kapitalfonder äger 4–6 procent var av koncernens moderbolag, som äger 100 procent av ett holdingbolag, som i sin tur äger 100 procent av ett finländskt skattskyldigt bolag. Kapitalfonderna A, B och C har rätt att få 20 procent var av vinsten i det finländska skattskyldiga bolaget. Beloppet av koncernens eget kapital enligt koncernbokslutet är 20 miljoner euro negativt och det skatteskyldiga bolagets eget kapital är sju miljoner euro positivt. Kapitalfonderna har gett moderbolaget i koncernen ett lån på 50 miljoner euro och det skattskyldiga bolaget ett lån på 60 miljoner euro. Kapitalfondernas A, B och C andel av lånen som getts till det skattskyldiga bolaget är totalt 30 miljoner euro. Fonderna har inte tillhandhållit lån till moderbolaget. Mellan det skattskyldiga bolaget och moderbolaget finns inget skuldförhållande. Inga kapitalfonder eller andra aktörer har bestämmande inflytande i moderbolaget. I moderbolagets koncernbalansräkning som ingår i det revisorsgranskade och fastställda koncernbokslutet finns det skattskyldiga bolagets skuld till kapitalfonderna (sammanlagt 60 miljoner euro) och skulden som moderbolaget i koncernen har till kapitalfonderna (50 miljoner euro). I den skattskyldiges och koncernens balansräkningar finns inga andra skulder än ovan nämnda.

Koncernbalansräkningens eget kapital ska i en dylik situation korrigeras beträffande skulden till kapitalfonderna A, B och C, eftersom kapitalfonderna har rätt att få minst tio procent av den vinst den skattskyldige avkastar.

Skulden till kapitalfonderna A, B och C (sammanlagt 30 miljoner euro) betraktas som eget kapital i koncernbalansräkningen när jämförelsen av balansräkningar görs. Soliditetsgraden (eget kapital i relation till balansomslutningen) hos det skattskyldiga bolaget som yrkar på jämförelse av balansräkningar är svagare än hela koncernens soliditetsgrad och undantaget som grundar sig på en jämförelse av balansräkningar tillämpas inte.

Exempel 29 i bildform.

När bestämmelsen tillämpas följs begreppen i bokföringen, då det gäller att avgöra vilka poster i balansräkningen som är eget kapital och vilka som är främmande kapital, och till vilka delar korrigeringar behöver göras. Bestämmelsen gäller alla skulder som syns i koncernbalansräkningen oavsett vilket koncernbolag som är gäldenär.

Korrigeringar i eget kapital görs i balansräkningen i ett fastställt och revisorsgranskat koncernbokslut eller i en omvandlad koncernbalansräkning, om koncernbalansräkningen omvandlats. Enligt regeringens proposition (RP 211/2021 rd) gäller det krav på revision som fogats till NärSkL 18 b § 1 mom. 4 punkten dock inte sådana korrigerade balansräkningar, där en skuld har betraktats som eget kapital med stöd av den nya sista meningen i 5 mom.

6.5 Yrkande på tillämpning av undantaget och utredningsskyldighet 

Tillämpning av undantaget som baserar sig på en jämförelse av balansräkningar yrkas varje skatteår och det gäller endast ränteutgifter för det skatteår som jämförelsen tillämpas på.  Företaget kan således inte dra av icke avdragsgilla nettoränteutgifter från tidigare år under det skatteår då undantaget tillämpas.

Den skattskyldige ska yrka på tillämpning av undantaget på en bilageblankett till skattedeklarationen och är skyldig att utreda att villkoren för tillämpning uppfylls (se FiUB 32/2021 rd, s.4). Den skattskyldige ska på begäran, till stöd för sitt yrkande, lägga fram ett fastställt och revisorsgranskat koncernbokslut (vid behov översatt till finska eller svenska), koncernschema och vid behov en omvandlad balansräkning i enlighet med NärSkL 18 b § 5 mom. och en redogörelse över en korrigering av eget kapital i koncernbalansräkningen enligt samma moment.  Skatteförvaltningen kan också vid behov kräva av företaget någon annan utredning över att förutsättningarna för undantaget som grundar sig på en jämförelse av balansräkningar uppfylls (BFL 7–14 §).

ledande skattesakkunnig Lauri Savander

överinspektör Mikael Kontro